[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53640.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:160 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 44->132 AROA_HALHL 6e-04 38.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53640.1 GT:GENE BAF53640.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(728129..728611) GB:FROM 728129 GB:TO 728611 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53640.1 LENGTH 160 SQ:AASEQ MIDQRSSLIAVDTETGADGLFVVISATAGQHALHDDVFRNLVVNNTIEGLASFGKQVSQDVSLLNGAWETIQKEAFCSIGLSKAGSNHTCSHVGWNQLASVDVLLGLDTQRGTLANVGAEKIASRNVRNAKLLRENCSLGALTSTGRSEEYESHYFRSPS GT:EXON 1|1-160:0| BL:SWS:NREP 1 BL:SWS:REP 44->132|AROA_HALHL|6e-04|38.2|89/444| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,149-161| PSIPRED cccccccEEEEEccccccEEEEEEEEccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccHHHHccccHHHHHccEEEEEEEEEcccccccHHHHccHHHHccccccHHHHHHHHcccHHHHcccccHHHHHHHccccc //