[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53658.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:152 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   73->141 3i3gA PDBj 8e-05 34.8 %
:RPS:PDB   67->150 3efaA PDBj 4e-09 11.9 %
:RPS:SCOP  21->145 1q2yA  d.108.1.1 * 1e-10 24.3 %
:HMM:SCOP  1->152 1p0hA_ d.108.1.1 * 2.4e-18 26.7 %
:HMM:PFM   85->142 PF00583 * Acetyltransf_1 1.9e-10 29.3 58/83  
:BLT:SWISS 98->144 YAO2_SCHPO 5e-05 38.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53658.1 GT:GENE BAF53658.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(746122..746580) GB:FROM 746122 GB:TO 746580 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53658.1 LENGTH 152 SQ:AASEQ MWKDLTEPLPEACAEGFEIRVVKSPEELADYAAVLSANWNPPAETVQRFYAEAAEYALSEESSAHYLVGYVYGRAVCSAEAFIHASVAGIYNISTLENERRRGYGGAITLATLHTARNAGCDTAVLQASEDGEPVYRKLGFTDCGRFTEYSL GT:EXON 1|1-152:0| BL:SWS:NREP 1 BL:SWS:REP 98->144|YAO2_SCHPO|5e-05|38.3|47/100| SEG 50->66|yaeaaeyalseessahy| BL:PDB:NREP 1 BL:PDB:REP 73->141|3i3gA|8e-05|34.8|69/143| RP:PDB:NREP 1 RP:PDB:REP 67->150|3efaA|4e-09|11.9|84/143| HM:PFM:NREP 1 HM:PFM:REP 85->142|PF00583|1.9e-10|29.3|58/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 21->145|1q2yA|1e-10|24.3|115/140|d.108.1.1| HM:SCP:REP 1->152|1p0hA_|2.4e-18|26.7|146/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 26 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- --------111--------------------------1-------1--------------------1-----------------------------------------------------------------------------------------------------1---------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111----222211------------------------------------------------1---------1--------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 97.4 SQ:SECSTR ###cccEEEEEEEEEEEEEEccc#EEcGGGGHHHHHHGHTcTTccGGGGcGGGGcTTcEEEEEEETEEEEETTEEEEEEEEEEccTTEEEEEEEEcGGGTTccHHHHHHHHHHHHHHHTTccEEEEEEEGGGHHHHHHTTcEEEEcccccEE PSIPRED cccccccccccccccccEEEEEccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccEEEEEEEccEEEEEEEEEEEccEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHcccEEEEEEEEEEc //