[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53671.1
DDBJ      :             hypothetical protein
Swiss-Prot:RS9_CORGL    RecName: Full=30S ribosomal protein S9;

Homologs  Archaea  7/68 : Bacteria  909/915 : Eukaryota  162/199 : Viruses  0/175   --->[See Alignment]
d.14.1
:182 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   62->182 1vs5I PDBj 2e-31 52.1 %
:RPS:PDB   58->182 3bbnI PDBj 4e-45 49.6 %
:RPS:SCOP  58->182 1fjgI  d.14.1.1 * 2e-45 52.0 %
:HMM:SCOP  56->182 1fjgI_ d.14.1.1 * 1.5e-44 58.3 %
:RPS:PFM   62->182 PF00380 * Ribosomal_S9 3e-27 57.9 %
:HMM:PFM   62->182 PF00380 * Ribosomal_S9 2.6e-45 52.1 121/121  
:BLT:SWISS 1->182 RS9_CORGL 4e-83 100.0 %
:PROS 121->139|PS00360|RIBOSOMAL_S9
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53671.1 GT:GENE BAF53671.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 761242..761790 GB:FROM 761242 GB:TO 761790 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53671.1 LENGTH 182 SQ:AASEQ MSEPIQNENVESNVADAADIAAATAATEEFTNTIGDAIATASEEETIEAAPVVLDGPIQTVGRRKRAIVRVRLVAGSGEFKCNGRTLEEYFPNKLHQQLIKAPLVLLDRENQFDIVATLKGGGPTGQAGAFRLAIARALNAYNPAERGELKKAGFLTRDARAVERKKAGLHKARRAPQYSKR GT:EXON 1|1-182:0| SW:ID RS9_CORGL SW:DE RecName: Full=30S ribosomal protein S9; SW:GN Name=rpsI; OrderedLocusNames=Cgl0582, cg0674; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->182|RS9_CORGL|4e-83|100.0|182/182| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 121->139|PS00360|RIBOSOMAL_S9|PDOC00311| SEG 15->27|adaadiaaataat| SEG 37->50|aiataseeetieaa| BL:PDB:NREP 1 BL:PDB:REP 62->182|1vs5I|2e-31|52.1|121/127| RP:PDB:NREP 1 RP:PDB:REP 58->182|3bbnI|4e-45|49.6|125/127| RP:PFM:NREP 1 RP:PFM:REP 62->182|PF00380|3e-27|57.9|121/121|Ribosomal_S9| HM:PFM:NREP 1 HM:PFM:REP 62->182|PF00380|2.6e-45|52.1|121/121|Ribosomal_S9| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00380|IPR000754| GO:PFM GO:0005622|"GO:intracellular"|PF00380|IPR000754| GO:PFM GO:0005840|"GO:ribosome"|PF00380|IPR000754| GO:PFM GO:0006412|"GO:translation"|PF00380|IPR000754| RP:SCP:NREP 1 RP:SCP:REP 58->182|1fjgI|2e-45|52.0|125/127|d.14.1.1| HM:SCP:REP 56->182|1fjgI_|1.5e-44|58.3|127/127|d.14.1.1|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 1149 OP:NHOMOORG 1078 OP:PATTERN -----------------1-1111--------------------------------------1--1--- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111112111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 1---112-1------1111111111111111-111112111111111111111111111111111111-1111-11111111111111--111111------1111-12213212111-11-2142-21242-223111121-31---1-11121221211-12112111---112--2O2121122431221111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 125 STR:RPRED 68.7 SQ:SECSTR #########################################################cccccEETTEEEEEEEEEccccEEETTEEHHHHccccGGGTTTcHHHHTTTcTTTEEEEEEEEcccHHHHHHHHHHHHHHHTTTccGGGcHHHHTTTcccccccccccccTTcccTTcccccccc DISOP:02AL 1-7,33-48,164-172,176-176| PSIPRED ccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccEEccEEEEEEEEEEEEEEEEEEEccccEEEEccEEHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccccccccccccccccccccccccc //