[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53675.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53675.1 GT:GENE BAF53675.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(765590..765907) GB:FROM 765590 GB:TO 765907 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53675.1 LENGTH 105 SQ:AASEQ MILFGTNAVLRFCTNQDHPFLVLGFPQYRFHRPPTSLLSPCHPNRFFQRLNHNRLFLLFHIFRHIIKLSLSRSDCLFELFHPLSCALSKLLEKFRILHRYHPPAL GT:EXON 1|1-105:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 104-106| PSIPRED cEEEEcHHHHHHHccccccEEEEEcccHHcccccHHHcccccHHHHHHHHcccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //