[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53688.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  47/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:99 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   17->84 PF02467 * Whib 2e-09 42.9 %
:HMM:PFM   17->84 PF02467 * Whib 1.6e-26 60.3 63/66  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53688.1 GT:GENE BAF53688.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(778319..778618) GB:FROM 778319 GB:TO 778618 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53688.1 LENGTH 99 SQ:AASEQ MTLPHQLPGPNADFWDWQLHGTCRGETSDVFYHPDGERGRARQRRELRAKAICAACPVLESCRKHALAVAEPYGVWGGLSESERLVILRNNERKQPVAV GT:EXON 1|1-99:0| SEG 36->49|gergrarqrrelra| RP:PFM:NREP 1 RP:PFM:REP 17->84|PF02467|2e-09|42.9|63/66|Whib| HM:PFM:NREP 1 HM:PFM:REP 17->84|PF02467|1.6e-26|60.3|63/66|Whib| OP:NHOMO 91 OP:NHOMOORG 47 OP:PATTERN -------------------------------------------------------------------- ----21-111111-21111-111111111111111114NA-11131-11---------------3212221---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,91-100| PSIPRED ccccccccccccccccHHHHHHHccccHHHHccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccEEEccccHHHHHHHHHHHHccccccc //