[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53689.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:60 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->52 PF04480 * DUF559 0.00016 22.4 49/109  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53689.1 GT:GENE BAF53689.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 779060..779242 GB:FROM 779060 GB:TO 779242 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53689.1 LENGTH 60 SQ:AASEQ MADTERELATLVPQATAGDRRALQRIMEIIHPMFCVMLALVLEVDGSQRQKTLLKRSVWQ GT:EXON 1|1-60:0| HM:PFM:NREP 1 HM:PFM:REP 4->52|PF04480|0.00016|22.4|49/109|DUF559| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,60-61| PSIPRED cccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcc //