[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53703.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:147 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->136 PF01040 * UbiA 0.00013 24.8 113/258  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53703.1 GT:GENE BAF53703.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(791943..792386) GB:FROM 791943 GB:TO 792386 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53703.1 LENGTH 147 SQ:AASEQ MDPMSSYNDMKSHTTPIPTPVSVRLSSSVLVGAAIASLTTDLAPAVKFSVTGIGLALALLIAFVHPYRGEMRMYRFQNNISPVPTIGQVMPLFFTWLALMLAPIISGAPLWATLLVFLAATGWMYLTFPHVDGSRKLAFAEGPRRNT GT:EXON 1|1-147:0| TM:NTM 2 TM:REGION 34->56| TM:REGION 94->116| SEG 21->31|vsvrlsssvlv| SEG 52->62|giglalallia| HM:PFM:NREP 1 HM:PFM:REP 18->136|PF01040|0.00013|24.8|113/258|UbiA| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -----111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,144-148| PSIPRED ccccHHHHHHHHHccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHccccccccccEEEHHccccccc //