[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53707.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:263 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->53 PF10440 * WIYLD 0.001 35.7 28/65  
:BLT:SWISS 53->158 Y3395_MYCTU 2e-13 36.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53707.1 GT:GENE BAF53707.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 808714..809505 GB:FROM 808714 GB:TO 809505 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53707.1 LENGTH 263 SQ:AASEQ MGGTGVRKLWGDGTPVSLPDLSELSRAERIDALRSRMSTMGAAVPKFEPSVEESAEQKQDSLAEKQDIVAVPSAFSDLFPGGGLPRRAVTQLVEQPLVVVDFLAHITAQGGHAAVIGWKDLAYAGVIDSGGVCENIIAIPNPGTEPLNVAAVLCEGLDVVVYKGPEISLSPTRARPLLGKLRQGTAALVMVGTKVASPALTVDAEITDYVGIGAGSGRIRGVEMQVRAVSKTHGVRSGKVMISRPQDAALFEPEQPTTLRAVP GT:EXON 1|1-263:0| BL:SWS:NREP 1 BL:SWS:REP 53->158|Y3395_MYCTU|2e-13|36.5|104/100| HM:PFM:NREP 1 HM:PFM:REP 26->53|PF10440|0.001|35.7|28/65|WIYLD| OP:NHOMO 24 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- -----1111111111--11-11----11111-1----3--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,40-62,259-264| PSIPRED ccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEccHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEcccccHHHHHHccccHHEEEEEccccccHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHHcccEEEEEEcccccccEEEEEEEEEccccccccccEEEEEEEEEEEEEccccccccEEEEEcccccccccccccccccccc //