[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53725.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  537/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   43->288 1p99A PDBj 7e-32 31.3 %
:RPS:PDB   38->297 1biyA PDBj 2e-18 9.6 %
:RPS:SCOP  43->292 1p99A  c.94.1.1 * 8e-67 33.2 %
:HMM:SCOP  42->293 1p99A_ c.94.1.1 * 1e-64 39.7 %
:RPS:PFM   65->277 PF03180 * Lipoprotein_9 2e-37 41.1 %
:HMM:PFM   43->278 PF03180 * Lipoprotein_9 3.1e-57 32.5 234/237  
:BLT:SWISS 1->276 METQ_YERPE 2e-32 33.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53725.1 GT:GENE BAF53725.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(831330..832229) GB:FROM 831330 GB:TO 832229 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53725.1 LENGTH 299 SQ:AASEQ MKLRRITTTAIAGLFAATALVACGSDSDGSSTTVSEGAEGVTIRIGATDASKEAWAVFEEKAADEGITLDIVPFSDYSTPNEALAQDQLDVNLFQHLKFLAEYNVGSGADLTPVGSSEIVPLALFWKDHDSIDGIDGESVAIPNDPSNQGRAINVLVQAGLVTLKTPGLVTPAPVDIDEAASKVSVIPVDAAQAPTAYQEGRPAIINNSFLDRAGIDPNLAVFEDDPESEEAEPYINVFVTKAEDKDDANIARLVELWHDPEVLAAVDRDSEGTSVPVDRPAADLQEILDRLEADQENA GT:EXON 1|1-299:0| BL:SWS:NREP 1 BL:SWS:REP 1->276|METQ_YERPE|2e-32|33.2|262/271| SEG 24->33|gsdsdgsstt| BL:PDB:NREP 1 BL:PDB:REP 43->288|1p99A|7e-32|31.3|246/255| RP:PDB:NREP 1 RP:PDB:REP 38->297|1biyA|2e-18|9.6|260/689| RP:PFM:NREP 1 RP:PFM:REP 65->277|PF03180|2e-37|41.1|209/236|Lipoprotein_9| HM:PFM:NREP 1 HM:PFM:REP 43->278|PF03180|3.1e-57|32.5|234/237|Lipoprotein_9| RP:SCP:NREP 1 RP:SCP:REP 43->292|1p99A|8e-67|33.2|250/257|c.94.1.1| HM:SCP:REP 42->293|1p99A_|1e-64|39.7|252/255|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1041 OP:NHOMOORG 540 OP:PATTERN -------------------------------------------------------------------- -----2211111111----------2------1---111-----121211111-1111-----111121111222111-121-------------------1---------------11111111----------------------------------------------------------1-2------12444444442444444313312344112244322222223322222222222222322223211231311132334412122144422241111111111111111111111111111111112221111-2112333333312--2221---111211----11-1-11-1-11-1-11---111-111-11-125---322-222222222213---2--2-2-1--21121111111132-----11411---11111111-11---13-----------------------------------343435454552444255334444235483245--222--2228-113--------111111111--------------1-------------------1----2211444441121111111-1-----221-1-----1--------------------------------43431422222222222-2222222222222222221454441142222222222222222422211121-322222222222--1-111111111---1-22211111111211144444321111-33333543234341333111111111-1111111111211111111111111111---4---------------1----------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------4-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 263 STR:RPRED 88.0 SQ:SECSTR ####################################ccTTcccEEEcHHHHHHHHHHHHHHHTTcccccEEEccccHHHHHHHHHTTccccEEEcHHHHHHHTcTTccEETTEEEcEEEEEEEEEcccccccTTcTTcEEEEcccccTTTTHHHHHGGGGcccTTTccHHHHHHHHccEEEcTTccTTTcHHHHHHcccccTTTTcccTTcTTccccHHHHHHHcccccEEEEHHHHHHcccHHHHTTEEEEcTTccEEEGGGTTTcccEEEEccEEEEEcccccHHHHHHHHHHHHHH DISOP:02AL 1-2,26-40,294-300| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEcccHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHcccccEEEEccHHHHHHHHHHccccEEEEEEEEEEEEEEEccccccHHHccccEEEEccccccHHHHHHHHHHcccEEEcccccccccHHHHHHcccccEEEEEcHHHHHHHcccccEEEEccHHHHHccccccHHHHHccccccccccEEEEEEEcHHHcccHHHHHHHHHHccHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHHHHcc //