[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53729.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  53/68 : Bacteria  321/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.76.1b.34.1
:223 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->186 1u8rH PDBj 5e-23 34.6 %
:RPS:PDB   5->142 1bi2B PDBj 1e-11 32.4 %
:RPS:PDB   149->222 3e19C PDBj 4e-08 16.9 %
:RPS:SCOP  3->58 1b1bA1  a.4.5.24 * 2e-12 31.5 %
:RPS:SCOP  69->140 1b1bA2  a.76.1.1 * 7e-25 44.4 %
:RPS:SCOP  148->208 1bi0A3  b.34.1.2 * 2e-08 15.8 %
:HMM:SCOP  6->68 1g3sA1 a.4.5.24 * 3.4e-11 42.6 %
:HMM:SCOP  69->144 1g3sA2 a.76.1.1 * 3.1e-25 51.3 %
:HMM:SCOP  134->224 1bymA_ b.34.1.2 * 1.5e-07 28.7 %
:RPS:PFM   6->66 PF01325 * Fe_dep_repress 8e-07 39.0 %
:RPS:PFM   69->133 PF02742 * Fe_dep_repr_C 2e-14 47.7 %
:RPS:PFM   151->205 PF04023 * FeoA 2e-06 45.5 %
:HMM:PFM   69->138 PF02742 * Fe_dep_repr_C 5.4e-33 58.6 70/71  
:HMM:PFM   6->66 PF01325 * Fe_dep_repress 4.7e-18 39.0 59/60  
:HMM:PFM   149->205 PF04023 * FeoA 1.6e-14 36.8 57/74  
:HMM:PFM   47->87 PF04458 * DUF505 0.00043 41.5 41/591  
:BLT:SWISS 3->204 IDER_MYCLE 5e-24 33.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53729.1 GT:GENE BAF53729.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 837488..838159 GB:FROM 837488 GB:TO 838159 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53729.1 LENGTH 223 SQ:AASEQ MHISDLPDRSQDYLKTIWDITELLDDQPAALGDIAEKMNQKTPTASEAIKKLAARGLVNHEKYAGVTLTEQGKMLAIDMVRRHRLLETFLHDVLGYTWDEVHADADLLEHAASDQLIERIDAHLGRPRKDPHGDPIPTAEGVIEESPRTTLEAVQPGETVTISRVKDIDPELLRYLAQYNVSPGCRITVASGPLAGMVHVVVEGTDTSFPLAETQLPLITVQD GT:EXON 1|1-223:0| BL:SWS:NREP 1 BL:SWS:REP 3->204|IDER_MYCLE|5e-24|33.8|198/230| BL:PDB:NREP 1 BL:PDB:REP 3->186|1u8rH|5e-23|34.6|182/222| RP:PDB:NREP 2 RP:PDB:REP 5->142|1bi2B|1e-11|32.4|136/138| RP:PDB:REP 149->222|3e19C|4e-08|16.9|71/77| RP:PFM:NREP 3 RP:PFM:REP 6->66|PF01325|8e-07|39.0|59/59|Fe_dep_repress| RP:PFM:REP 69->133|PF02742|2e-14|47.7|65/68|Fe_dep_repr_C| RP:PFM:REP 151->205|PF04023|2e-06|45.5|55/74|FeoA| HM:PFM:NREP 4 HM:PFM:REP 69->138|PF02742|5.4e-33|58.6|70/71|Fe_dep_repr_C| HM:PFM:REP 6->66|PF01325|4.7e-18|39.0|59/60|Fe_dep_repress| HM:PFM:REP 149->205|PF04023|1.6e-14|36.8|57/74|FeoA| HM:PFM:REP 47->87|PF04458|0.00043|41.5|41/591|DUF505| GO:PFM:NREP 7 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01325|IPR001367| GO:PFM GO:0005506|"GO:iron ion binding"|PF01325|IPR001367| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01325|IPR001367| GO:PFM GO:0003700|"GO:transcription factor activity"|PF02742|IPR001367| GO:PFM GO:0005506|"GO:iron ion binding"|PF02742|IPR001367| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF02742|IPR001367| GO:PFM GO:0005506|"GO:iron ion binding"|PF04023|IPR007167| RP:SCP:NREP 3 RP:SCP:REP 3->58|1b1bA1|2e-12|31.5|54/64|a.4.5.24| RP:SCP:REP 69->140|1b1bA2|7e-25|44.4|72/76|a.76.1.1| RP:SCP:REP 148->208|1bi0A3|2e-08|15.8|57/77|b.34.1.2| HM:SCP:REP 6->68|1g3sA1|3.4e-11|42.6|61/0|a.4.5.24|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 69->144|1g3sA2|3.1e-25|51.3|76/0|a.76.1.1|1/1|Iron-dependent repressor protein, dimerization domain| HM:SCP:REP 134->224|1bymA_|1.5e-07|28.7|87/0|b.34.1.2|1/1|C-terminal domain of transcriptional repressors| OP:NHOMO 480 OP:NHOMOORG 374 OP:PATTERN -----121111111121------1222123231121111111112121-1212-111111-2111-12 1-1-132233422322222-221122222222222222231111222122223233121111111221212-------1-1-1-----------111--11111112112-------1-1------1-1-----1143334--111-------------------------------------31111--11111111111111111-1-1111111111111---------1111111111111111111111-1-11-1---11111111----1111111111111111111111111111111111111111---1111------------1-1--221----111-----122--------------11-----------1------------------------1111111111--1--1--1----------2------------------111---------------------------------------------------------------------------------------------------------------12-111--1-----2-2--1--21111---2----------------------------------------------------------------------11---111111111111-111111111111111111----------1--------------111-11111--------------1---------------------------------------------------------------------2--------------1111111111-------1--------------211--------------------------11-------111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 220 STR:RPRED 98.7 SQ:SECSTR HHHTcHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEcTTccEEEcHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHccHHHHHHHHHHcccccccTTccccccHHHHTccccEEHccHHHHHcHHHHHHHHTTTcccccccGGTTccTTcEEEEEEcEETTEEEEEccccEEEccHHHHT##TEEEE# DISOP:02AL 1-4,223-224| PSIPRED ccHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHHHcccEEEccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccccccccccccccHHHcccccEEEEEEEEEccHHHHHHHHHcccccccEEEEEEcccccEEEEEEccEEEEEcccHHHHccEEccc //