[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53732.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  65/915 : Eukaryota  17/199 : Viruses  0/175   --->[See Alignment]
c.97.1
:164 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->94 1wkqB PDBj 6e-09 36.5 %
:RPS:PDB   3->161 2b3jA PDBj 1e-19 18.7 %
:RPS:SCOP  4->110 1tiyA  c.97.1.2 * 3e-20 30.2 %
:HMM:SCOP  3->132 2a8nA1 c.97.1.2 * 5.9e-21 25.6 %
:RPS:PFM   13->90 PF00383 * dCMP_cyt_deam_1 4e-04 31.2 %
:HMM:PFM   4->102 PF00383 * dCMP_cyt_deam_1 3.3e-12 30.6 98/102  
:BLT:SWISS 1->157 FCYS_SCHPO 1e-16 34.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53732.1 GT:GENE BAF53732.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 839874..840368 GB:FROM 839874 GB:TO 840368 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53732.1 LENGTH 164 SQ:AASEQ MTEDDLDLLHRTVELATQALKQGNSPYGSLLVDPFGAVVFEDHNRDADGDLTKHPEFAIAKYAIENYSASERAACTVYTSTEHCAMCAGAHAWAGLGKIYCATTGEQTAAWYAKWGAESGPLNPISADKISPNISIEGPASRFEEVLYELHRWFYLGQSPDKAL GT:EXON 1|1-164:0| BL:SWS:NREP 1 BL:SWS:REP 1->157|FCYS_SCHPO|1e-16|34.2|152/162| BL:PDB:NREP 1 BL:PDB:REP 9->94|1wkqB|6e-09|36.5|85/155| RP:PDB:NREP 1 RP:PDB:REP 3->161|2b3jA|1e-19|18.7|150/151| RP:PFM:NREP 1 RP:PFM:REP 13->90|PF00383|4e-04|31.2|77/100|dCMP_cyt_deam_1| HM:PFM:NREP 1 HM:PFM:REP 4->102|PF00383|3.3e-12|30.6|98/102|dCMP_cyt_deam_1| GO:PFM:NREP 2 GO:PFM GO:0008270|"GO:zinc ion binding"|PF00383|IPR002125| GO:PFM GO:0016787|"GO:hydrolase activity"|PF00383|IPR002125| RP:SCP:NREP 1 RP:SCP:REP 4->110|1tiyA|3e-20|30.2|106/157|c.97.1.2| HM:SCP:REP 3->132|2a8nA1|5.9e-21|25.6|129/0|c.97.1.2|1/1|Cytidine deaminase-like| OP:NHOMO 95 OP:NHOMOORG 89 OP:PATTERN ------------------------1--11-1-------------------111--------------- ----1--1111---1------1---1------11111121-----11------------------1111-2--------------------1--11------------1----------------------------------------------------------------------------------------------------1------------2---------1---------------------1-------11---------------------------------------------------------------------------------------------------------------------------111-------------------------1------1--1-11111--------------------------11----------------------------------------------------------11--------1--1--------11-2---2--1---------------1----------------------1----------1--------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------1---------------------1-1--------11------1---------------------------------------------------------------------------------------------------- -----------------------1-11--------------------111111111-------------------------------1---------------1-----1-----------------------------------------------------1----------------------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 162 STR:RPRED 98.8 SQ:SECSTR cHHHHHHHHHHHHHHHHHHHHTTccccEEEEEETTEEEEEEEccHHHHTcTTccHHHHHHHHHHHHHTccccTTEEEEEEEcccHHHHHHHHHTTccEEEEEEccTTTEEccTTTcTcTTcccTTccTTcccccEEEccTcTTHHHHHHHHHHHHHHHHHcc## DISOP:02AL 1-1,160-165| PSIPRED ccHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccEEEEEEccccccccccHHHHHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHccccEEEEEEEcccHHHHHHcccccccccccccHHHHccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHcc //