[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53733.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  131/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:332 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->235 3eixA PDBj 2e-07 27.3 %
:RPS:PDB   44->332 3eiwA PDBj 6e-30 19.5 %
:RPS:SCOP  47->324 2phzA1  c.92.2.4 * 6e-24 16.2 %
:HMM:SCOP  58->327 1efdN_ c.92.2.1 * 8e-44 31.1 %
:RPS:PFM   120->197 PF01497 * Peripla_BP_2 1e-05 34.2 %
:HMM:PFM   64->299 PF01497 * Peripla_BP_2 3.8e-21 26.1 222/238  
:HMM:PFM   7->57 PF05481 * Myco_19_kDa 6.5e-05 31.4 51/160  
:BLT:SWISS 47->240 YFIY_BACSU 6e-13 31.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53733.1 GT:GENE BAF53733.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 840484..841482 GB:FROM 840484 GB:TO 841482 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53733.1 LENGTH 332 SQ:AASEQ MQSRLSKILRSSVVGVAVLALLAGCSSNADDTDADSTSTGNSAFPVSIEHEFGTTTIDDVPERIVTLGVTDADIVLALGTVPVGNTGYKFFENGLGPWTDELVEGKELTLLDSDSTPDLEQVAVLEPDLIIGVSAGFDDVVYEQLSDIAPVVARPAGTAAYAVAREEATSLVARAMGQSEKGQELNEETDALIQAARDENPSFDGKTGTVILPYQGKYGAYLPGDTRGQFLDSLGISLPEAVLSRDTGDSFFVDVPAESVKDVDGDVLLVLSNDENLDITAENPLFETLNVVQNDAVIVATTEERGAITYNSVLSVPFALEHLAPRIAEALK GT:EXON 1|1-332:0| BL:SWS:NREP 1 BL:SWS:REP 47->240|YFIY_BACSU|6e-13|31.4|185/325| SEG 13->24|vvgvavlallag| SEG 26->43|ssnaddtdadststgnsa| SEG 108->119|ltlldsdstpdl| SEG 262->271|dvdgdvllvl| BL:PDB:NREP 1 BL:PDB:REP 46->235|3eixA|2e-07|27.3|183/287| RP:PDB:NREP 1 RP:PDB:REP 44->332|3eiwA|6e-30|19.5|282/292| RP:PFM:NREP 1 RP:PFM:REP 120->197|PF01497|1e-05|34.2|76/235|Peripla_BP_2| HM:PFM:NREP 2 HM:PFM:REP 64->299|PF01497|3.8e-21|26.1|222/238|Peripla_BP_2| HM:PFM:REP 7->57|PF05481|6.5e-05|31.4|51/160|Myco_19_kDa| GO:PFM:NREP 2 GO:PFM GO:0005381|"GO:iron ion transmembrane transporter activity"|PF01497|IPR002491| GO:PFM GO:0006827|"GO:high-affinity iron ion transport"|PF01497|IPR002491| RP:SCP:NREP 1 RP:SCP:REP 47->324|2phzA1|6e-24|16.2|266/277|c.92.2.4| HM:SCP:REP 58->327|1efdN_|8e-44|31.1|257/262|c.92.2.1|1/1|"Helical backbone" metal receptor| OP:NHOMO 221 OP:NHOMOORG 131 OP:PATTERN -------------------------------------------------------------------- -----41166632211111-11--1211111111111F58-1-14-11-11121111222----324-161-----------3------------------------------------------------------11-----1-1----------------2----2-----------------------1-111111-1-11111--233-111111112-2------31--------------------------------------------------------11111111111-------------------------1-1---------------1-1----------11--------------------------------------------------1--------------11--------1-------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------122222222222-----------------1------------------------------------------------------1-------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 289 STR:RPRED 87.0 SQ:SECSTR ###########################################cEEEEEETTEEEEEETTcccEEEccHHHHHHHHHTTccccEEccTTcGGGccHHHHHHHGGGcccEEccccccccHHHHHHTcccEEEEETTTTTTGTHHHHHHHccEEEEccTTccHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHccccTTccEEEEEEETTEEEEccTTcHHHHHHHHTTccccccHHHHHGEETTEEEEcHHHHHHHcccEEEEEEccHHHHHHHHcHHHHTcHHHHTTcEEEEcEEHHHHTTTccHHHHHHHHHHHHHHHHcccc DISOP:02AL 1-6,25-44| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEcccEEEEcccccEEEEEcHHHHHHHHHccccEEEEEEcccccccccHHHHHHccccccEEccccccccHHHHHHccccEEEEEcccccHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccEEEcccccHHHHHHHcccccccccHHccccccccccccHHHHHHHcccEEEEEcccccHHHHHHcHHHHccHHHHcccEEEEccHHHHHHccccHHHHHHHHHHHHHHHHHHcc //