[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53739.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:97 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->81 2ql3A PDBj 9e-11 39.7 %
:RPS:PDB   1->93 1al3A PDBj 3e-06 13.2 %
:RPS:SCOP  1->96 1al3A  c.94.1.1 * 8e-09 13.8 %
:HMM:SCOP  1->94 1uthA_ c.94.1.1 * 8.9e-10 28.0 %
:HMM:PFM   2->84 PF03466 * LysR_substrate 6.1e-15 28.8 80/209  
:BLT:SWISS 4->84 YCGK_BACSU 3e-04 29.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53739.1 GT:GENE BAF53739.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(846434..846727) GB:FROM 846434 GB:TO 846727 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53739.1 LENGTH 97 SQ:AASEQ MFEEAGVQPNIRYRTANHEVLRGLVAHGVGYSLLTQRTRKEFSHEGIEYATAEIADPYEPLEVIAVTPDQRWQSKKVAAFIEIAGKIINDPLAIQDT GT:EXON 1|1-97:0| BL:SWS:NREP 1 BL:SWS:REP 4->84|YCGK_BACSU|3e-04|29.9|77/324| BL:PDB:NREP 1 BL:PDB:REP 4->81|2ql3A|9e-11|39.7|78/200| RP:PDB:NREP 1 RP:PDB:REP 1->93|1al3A|3e-06|13.2|91/237| HM:PFM:NREP 1 HM:PFM:REP 2->84|PF03466|6.1e-15|28.8|80/209|LysR_substrate| RP:SCP:NREP 1 RP:SCP:REP 1->96|1al3A|8e-09|13.8|94/237|c.94.1.1| HM:SCP:REP 1->94|1uthA_|8.9e-10|28.0|93/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------1-------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 96.9 SQ:SECSTR HHHHHTcccEEEEEEccHHHHHHHHHHTccEEEEEGGGccTTTcTTcEEEEEEccTTcccEEEEEEEETTccccHHHHHHHHHHcTTccHHHHc### DISOP:02AL 95-98| PSIPRED cHHHcccccEEEEEcccHHHHHHHHHccEEEEEEEccccccccccccEEEEEEcccccccEEEEEEEcccccccHHHHHHHHHHHHHcccccHHccc //