[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53743.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  243/915 : Eukaryota  49/199 : Viruses  0/175   --->[See Alignment]
d.79.1
:136 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->135 1oniH PDBj 5e-14 37.0 %
:RPS:PDB   26->134 2dyyG PDBj 8e-27 33.6 %
:RPS:SCOP  27->133 1jd1A  d.79.1.1 * 2e-25 26.9 %
:HMM:SCOP  9->135 1qd9A_ d.79.1.1 * 6.5e-31 37.1 %
:RPS:PFM   26->134 PF01042 * Ribonuc_L-PSP 2e-13 46.2 %
:HMM:PFM   24->133 PF01042 * Ribonuc_L-PSP 7.5e-27 39.8 108/121  
:BLT:SWISS 26->134 Y709_SYNY3 6e-15 37.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53743.1 GT:GENE BAF53743.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 851477..851887 GB:FROM 851477 GB:TO 851887 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53743.1 LENGTH 136 SQ:AASEQ MKHTRIRPFNTKDTYPEQNLSNDLCQAVVANGVVYLRGQIGQDLDTRESVGIGDVEVQAEKAMSNIDMLLKEAGGDLEDIVKVTVYLTDIRYRETVYNVMGRWLKGVFPVSTGLVVEALARPEWLVEIDATAVLGE GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 26->134|Y709_SYNY3|6e-15|37.6|109/130| BL:PDB:NREP 1 BL:PDB:REP 26->135|1oniH|5e-14|37.0|108/135| RP:PDB:NREP 1 RP:PDB:REP 26->134|2dyyG|8e-27|33.6|107/125| RP:PFM:NREP 1 RP:PFM:REP 26->134|PF01042|2e-13|46.2|106/119|Ribonuc_L-PSP| HM:PFM:NREP 1 HM:PFM:REP 24->133|PF01042|7.5e-27|39.8|108/121|Ribonuc_L-PSP| RP:SCP:NREP 1 RP:SCP:REP 27->133|1jd1A|2e-25|26.9|104/126|d.79.1.1| HM:SCP:REP 9->135|1qd9A_|6.5e-31|37.1|124/0|d.79.1.1|1/1|YjgF-like| OP:NHOMO 382 OP:NHOMOORG 297 OP:PATTERN -----1-----------1---------11-------------------------1------------- --1-----112----1---------1------------111-----------3----1--11--------------------1--1--1111-1---------------1--------------------------------------1-11---11111-1--1-11--1-1--11111--1--1-------------1---------------------------------1------------------------------------------------------------------------------------------1---------------------------------------1-111--1---------------3-1---111-1----------4---1----2-1--1---------1311-----11-111-111111111--------------------------------------1-1---43311---11-----2211------3111142-----1----1-1-21--1-112221111111111111---1--1--------1-11-1--1--1-211---1--------1111111111---111---1112-1112----111----1-22-11---1111------------------------------------------112---------------------------------11111111111----11-1-111111222--------------122222221121133332333243321222---------1-11------1-1--11212112221----11---------------------------------------------------1---- ---------------------------------11-------------1-11-1--1--------------------------------------------1---------11222--1---1111121111-1111---1--1111---1-11-11-11--2111-1-2----1---1----1--------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 134 STR:RPRED 98.5 SQ:SECSTR HHHHHHHHHHHHTTccccccc#ccccEEEETTEEEEEEEccccTTTccccccccHHHHHHHHHHHHHHHHHHTTccGGGEEEEEEEEcccccHHHHHHHHHHHHTTTccEEEEEEccccGGGGccEEEEEEEEcc# DISOP:02AL 1-3| PSIPRED ccccEEEEEcccccccccccccccEEEEEEccEEEEEcEEEEccccccEEccccHHHHHHHHHHHHHHHHHHccccHHHEEEEEEEEccHHHHHHHHHHHHHHcccccccEEEEEEccccccccEEEEEEEEEEcc //