[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53744.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.153.1
:106 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  2->90 2imhA1  d.153.1.7 * 9e-07 24.4 %
:RPS:PFM   7->73 PF06267 * DUF1028 5e-06 34.3 %
:HMM:PFM   1->73 PF06267 * DUF1028 1.3e-23 42.5 73/190  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53744.1 GT:GENE BAF53744.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 852238..852558 GB:FROM 852238 GB:TO 852558 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53744.1 LENGTH 106 SQ:AASEQ MLKDPVVIEKMIQAFESSEGELETRLMGAMLAGLNAGGEAGPVHSAGIAVARSSGWAETDLRIDWSDQPIEDLSKLLQEWLIQRDDYVIRGIDPSKSPAYGVPGDE GT:EXON 1|1-106:0| SEG 26->41|lmgamlaglnaggeag| RP:PFM:NREP 1 RP:PFM:REP 7->73|PF06267|5e-06|34.3|67/189|DUF1028| HM:PFM:NREP 1 HM:PFM:REP 1->73|PF06267|1.3e-23|42.5|73/190|DUF1028| RP:SCP:NREP 1 RP:SCP:REP 2->90|2imhA1|9e-07|24.4|82/225|d.153.1.7| OP:NHOMO 52 OP:NHOMOORG 51 OP:PATTERN -------------------------------------------------------------------- ----------1--------------1------------11------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-----------1------1----1-111111111--------------------------------------------1-1-1---11-----1111------111--1-----------1--------------------------------------------------------------------------------------------1------------------------------------------------------------------------1-2------------------------------------------------------------11---------------------1-----11111111-1111----------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,36-40,104-107| PSIPRED ccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHcccccEEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccc //