[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53747.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  47/68 : Bacteria  752/915 : Eukaryota  189/199 : Viruses  0/175   --->[See Alignment]
c.67.1
:437 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->435 2ctzA PDBj 1e-82 44.1 %
:RPS:PDB   13->431 3e6gA PDBj e-104 38.3 %
:RPS:SCOP  14->437 1cs1A  c.67.1.3 * 1e-66 29.0 %
:HMM:SCOP  12->435 2ctzA1 c.67.1.3 * 1.5e-113 36.4 %
:RPS:PFM   16->435 PF01053 * Cys_Met_Meta_PP 2e-93 50.9 %
:HMM:PFM   15->434 PF01053 * Cys_Met_Meta_PP 1.4e-131 46.7 383/386  
:BLT:SWISS 14->429 CYSD_SCHPO 1e-84 44.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53747.1 GT:GENE BAF53747.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(855028..856341) GB:FROM 855028 GB:TO 856341 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53747.1 LENGTH 437 SQ:AASEQ MPKYDNSNADQWGFETRSIHAGQSVDAQTSARNLPIYQSTAFVFDSAEHAKQRFALEDLGPVYSRLTNPTVEALENRIASLEGGVHAVAFSSGQAATTNAILNLAGAGDHIVTSPRLYGGTETLFLITLNRLGIDVSFVENPDDPESWQAAVQPNTKAFFGETFANPQADVLDIPAVAEVAHRNSVPLIIDNTIATAALVRPLELGADVVVASLTKFYTGNGSGLGGVLIDGGKFDWTVEKDGKPVFPYFVTPDAAYHGLKYADLGAPAFGLKVRVGLLRDTGSTLSAFNAWAAVQGIDTLSLRLERHNENAIKVAEFLNNHEKVEKVNFAGLKDSPWYATKEKLGLKYTGSVLTFEIKGGKDEAWAFIDALKLHSNLANIGDVRSLVVHPATTTHSQSDEAGLARAGVTQSTVRLSVGIETIDDIIADLEGGFAAI GT:EXON 1|1-437:0| BL:SWS:NREP 1 BL:SWS:REP 14->429|CYSD_SCHPO|1e-84|44.7|412/429| SEG 220->233|gngsglggvlidgg| BL:PDB:NREP 1 BL:PDB:REP 14->435|2ctzA|1e-82|44.1|417/421| RP:PDB:NREP 1 RP:PDB:REP 13->431|3e6gA|e-104|38.3|363/368| RP:PFM:NREP 1 RP:PFM:REP 16->435|PF01053|2e-93|50.9|383/384|Cys_Met_Meta_PP| HM:PFM:NREP 1 HM:PFM:REP 15->434|PF01053|1.4e-131|46.7|383/386|Cys_Met_Meta_PP| GO:PFM:NREP 2 GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF01053|IPR000277| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF01053|IPR000277| RP:SCP:NREP 1 RP:SCP:REP 14->437|1cs1A|1e-66|29.0|379/384|c.67.1.3| HM:SCP:REP 12->435|2ctzA1|1.5e-113|36.4|420/0|c.67.1.3|1/1|PLP-dependent transferases| OP:NHOMO 2869 OP:NHOMOORG 988 OP:PATTERN 22-1-11111111111-111111-3332233321--------1451-1-1221-111-1--2221--- 174-421233222144333-33223533333244443567133355423442446456--324-333334346554441-131-----33222211---11435442344---------------2323322431144444---43---2--2--11222221----2-1-22222222222234322--12435555555555555556633435553453511333333752333333333333323334421-11113-1-331112-1-253323-------222122221211111111111111111222333222-241573333333231227721113241-5333-22--1-242333321316-33334-----35966533C467544444443446-67666846783-555666665866443433434544344222222224222335811-----------------------11112346424643463344644444333844441453465441143243455744664323111343222222222244221123-2-241----565354423444442112231122212112111111123121113332314434335455444444544355442--3321------52332332222222222-2222222232222222223333334462222222222222222422222222-32233333333322-311111111112214333334-22212223333332212231333344251656424221--------12223222222342233232333331111113122--11--------1----------------------------11--22222-22 ----112-631-2334444334334333333333533333333333333336644433333333523313323344524533343322-47343373122223433-2514151121111111122111372-21311111112111-1111111111111135241112233423235n4433465684633342225 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 437 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHTccHcHHHHHHHTTccccTTTcccccccccccccccccHHHHHHHHTTTTGGGcccccccHHHHHHHHHHHHHHTccEEEEEccHHHHHHHHHHTTccTTcEEEEEccccHHHHHHHHHHHHHHccEEEEEcTTTcHHHHHHHccTTEEEEEEEcccTTTcccccHHHHHHHHHHTTcEEEEEcccccTTTccGGGGTccEEEEETTTTTTcccccccEEEEEccccccTEEccETTTcHHHHcccGcccEEHHEEEcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHTcTTEEEEEcTTcTTcTTHHHHHHHHccccccEEEEEETTHHHHHHHHHHHccccEEcccccccccEEEcTTTTTTcccccTTTTTccccccEEEEEcccccHHHHHHHHTHHTccT DISOP:02AL 1-15| PSIPRED ccccccccHHHccHHHEEHccccccccccccccccccccEEEEcccHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHHcccEEEEEcccccccccccEEEcccEEEEEccccccccccEEEEEEEcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHccccccEEEEEEEcccHHHHHHHHHHcccEEEEcccccccEEEEccHHHHcccccHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHHcc //