[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53760.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  42/68 : Bacteria  618/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
f.22.1
:331 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   56->319 2nq2B PDBj 5e-18 31.0 %
:RPS:SCOP  56->325 1l7vA  f.22.1.1 * 1e-42 29.2 %
:HMM:SCOP  3->326 1l7vA_ f.22.1.1 * 7.8e-73 39.5 %
:RPS:PFM   28->325 PF01032 * FecCD 2e-38 36.2 %
:HMM:PFM   16->325 PF01032 * FecCD 2.6e-89 43.7 309/311  
:BLT:SWISS 47->327 FHUB_BACSU 1e-39 37.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53760.1 GT:GENE BAF53760.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(871438..872433) GB:FROM 871438 GB:TO 872433 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53760.1 LENGTH 331 SQ:AASEQ MSTTKKLLFLSATLVLLAVACVCSVKFGVRSTNTDDAIQALLGHSDTTEQAAALKRIPRTVLGIIIGAALAIAGTTMQAVTRNPLADPGIFGILAGASLAVVIGISFFGLAGAVPTMIVAVVGSAAAAVFVYTVGSLGRGGATPLKLALAGAATTAALTSLVSAVLLPRVDVMDRFRFWQIGGVGGAEWDRMALAAPFLAVGFLLCVLTSTGLNALALGDDVATSLGENVLRTRIVASIGAVILCGVATALAGPIAFVGLVVPHITRLIVGTDHRWLVPCSALAGAVLIVAADTFGRVVTRPSEIAVGIIMPLIGAPLFIWIIRRQKVKEL GT:EXON 1|1-331:0| BL:SWS:NREP 1 BL:SWS:REP 47->327|FHUB_BACSU|1e-39|37.1|280/384| TM:NTM 9 TM:REGION 8->30| TM:REGION 58->80| TM:REGION 87->109| TM:REGION 116->138| TM:REGION 145->167| TM:REGION 194->216| TM:REGION 239->261| TM:REGION 277->299| TM:REGION 303->324| SEG 7->25|llflsatlvllavacvcsv| SEG 62->74|lgiiigaalaiag| SEG 119->131|vavvgsaaaavfv| SEG 141->168|gatplklalagaattaaltslvsavllp| BL:PDB:NREP 1 BL:PDB:REP 56->319|2nq2B|5e-18|31.0|252/300| RP:PFM:NREP 1 RP:PFM:REP 28->325|PF01032|2e-38|36.2|298/313|FecCD| HM:PFM:NREP 1 HM:PFM:REP 16->325|PF01032|2.6e-89|43.7|309/311|FecCD| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF01032|IPR000522| GO:PFM GO:0006810|"GO:transport"|PF01032|IPR000522| GO:PFM GO:0016020|"GO:membrane"|PF01032|IPR000522| RP:SCP:NREP 1 RP:SCP:REP 56->325|1l7vA|1e-42|29.2|267/324|f.22.1.1| HM:SCP:REP 3->326|1l7vA_|7.8e-73|39.5|314/324|f.22.1.1|1/1|ABC transporter involved in vitamin B12 uptake, BtuC| OP:NHOMO 2389 OP:NHOMOORG 661 OP:PATTERN --2-------------1--2-112222213211--321212121164854D81-2222342-11---- ----2656AAC5551------1---3----------3C46-313234154316313-42224-8A7336I4--------1221-----3222-222-----11111122----------------13122111223144221137-6-2222-11--------42-1451-------------343--22-158EEFEFDEE7FEFFFE9999AAFFF4769654444444HF377676776777777433443-1----2---33-1--1-----1112223333111111111111112333333333333222111222223B4599998995A5242227562512-421-2DB2--312123222-5-31-1--122122211--2345343433333333336-21-11122322-5775463466652112-24B222232-11111111-331--22---------------------------------122222223334412222221-222213411-112--111-1111412--1111-1-151---1111--1-11-66222123-3111----1---3411111134-253-11112----------11---1134223111221122312112--3-232322---112-------F5562855777587853-656377937569755555399A9A6654344444444444444833744453-655555545555--2-----------154E222353--11-1--5--11-11-23213422231522321-455---------16453444447593311---------------111------------5-1------------------------11121122222-1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 268 STR:RPRED 81.0 SQ:SECSTR #######################################################cHHHHHHHHHHHHHHHHHHHHHHHHTTcTTccTTcccHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHTccTTTHHHHHHHHHccccTTccHHHHHHHHHHHHHHHHHHHHTTTGGGGGGccHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHccccccTTTHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcTcccccHHHHHHHHHHHHHHHHH######## DISOP:02AL 1-4,329-332| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //