[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53765.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->58 PF07690 * MFS_1 0.00055 23.1 52/353  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53765.1 GT:GENE BAF53765.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 876724..876915 GB:FROM 876724 GB:TO 876915 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53765.1 LENGTH 63 SQ:AASEQ MGKSFALLVLGAIILAGGVWYTIEVGHSVMAIVAALIMAAGGGIITWGLAVAADVNSPTSHKI GT:EXON 1|1-63:0| TM:NTM 2 TM:REGION 4->26| TM:REGION 30->52| SEG 6->19|allvlgaiilaggv| SEG 29->45|vmaivaalimaagggii| HM:PFM:NREP 1 HM:PFM:REP 7->58|PF07690|0.00055|23.1|52/353|MFS_1| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,58-64| PSIPRED cccHHHHHHHHHHHHcccEEEEEEEcHHHHHHHHHHHHHccccEEEEEEEEEEcccccccccc //