[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53795.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:138 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->135 PF11349 * DUF3151 1e-29 56.9 %
:HMM:PFM   7->134 PF11349 * DUF3151 3.1e-54 58.9 124/129  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53795.1 GT:GENE BAF53795.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(911491..911907) GB:FROM 911491 GB:TO 911907 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53795.1 LENGTH 138 SQ:AASEQ MVQINDMLAPPPVKLPEDPALGADPTLTSTAIAHPDSPLVWAYRAENLIKSASNDEEKIQAYAFARTGYHRSLDRLRANGWKGWGPVPFSHEPNQGVLRAIASLALAAKLIGEDNEYDRCRQMLSDADPEAVAVLLDK GT:EXON 1|1-138:0| SEG 98->110|lraiaslalaakl| RP:PFM:NREP 1 RP:PFM:REP 7->135|PF11349|1e-29|56.9|123/129|DUF3151| HM:PFM:NREP 1 HM:PFM:REP 7->134|PF11349|3.1e-54|58.9|124/129|DUF3151| OP:NHOMO 58 OP:NHOMOORG 58 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-111111111111111111-1-1111-11-11-111111--111-1111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,7-7| PSIPRED ccccHHccccccccccccHHHcccccHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHHcc //