[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53805.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:119 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53805.1 GT:GENE BAF53805.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 923540..923899 GB:FROM 923540 GB:TO 923899 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53805.1 LENGTH 119 SQ:AASEQ MKKNPLVEWVWVMDELGVGWCQCEKDPITGKAPHPVNKPLVTKSIISALGDVPDVMSNQDISLVVVDLWKFDTITPPIAESLMRSVKAVNGEMHPQYPTATAMAAIKHFSNTFDGQINA GT:EXON 1|1-119:0| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,118-120| PSIPRED cccccHHHHHHHHHHHcccEEEEccccccccccccccccHHHHHHHHHHcccHHHHcccccEEEEEEEEcccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccc //