[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53810.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  54/68 : Bacteria  856/915 : Eukaryota  180/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:251 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->251 1gegE PDBj 4e-23 33.1 %
:RPS:PDB   7->249 2d1yB PDBj 3e-36 27.5 %
:RPS:SCOP  10->248 1pwxA  c.2.1.2 * 2e-39 19.4 %
:HMM:SCOP  1->247 1zemA1 c.2.1.2 * 3.5e-64 37.2 %
:RPS:PFM   7->176 PF00106 * adh_short 1e-11 34.8 %
:HMM:PFM   8->175 PF00106 * adh_short 8.9e-26 31.2 157/167  
:BLT:SWISS 3->248 DHG2_BACME 1e-23 35.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53810.1 GT:GENE BAF53810.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(927085..927840) GB:FROM 927085 GB:TO 927840 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53810.1 LENGTH 251 SQ:AASEQ MLDISEQIVLVTGGARGLGRALSESFLREGARVVVNYHRSADAAAELAGEKAVAIQADVRDREQVKSMFAQAKEHFGSPITTVVNSALADFSFDGDARPKAEDITIERFNQQYTSAIEGALNTIQEALPGFKEVGSGRVINIGTNLFQNPTVPYHDYTAAKAALLSLTRTFAKDLGPRHITVNMVSGGLLRTTGASAATPEEVFDFIAAGTPLGSVTTPQELADASLFFASPWSRAVTGQNLVVDGGLVFN GT:EXON 1|1-251:0| BL:SWS:NREP 1 BL:SWS:REP 3->248|DHG2_BACME|1e-23|35.0|237/261| SEG 41->54|adaaaelagekava| BL:PDB:NREP 1 BL:PDB:REP 6->251|1gegE|4e-23|33.1|236/256| RP:PDB:NREP 1 RP:PDB:REP 7->249|2d1yB|3e-36|27.5|233/242| RP:PFM:NREP 1 RP:PFM:REP 7->176|PF00106|1e-11|34.8|161/169|adh_short| HM:PFM:NREP 1 HM:PFM:REP 8->175|PF00106|8.9e-26|31.2|157/167|adh_short| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 10->248|1pwxA|2e-39|19.4|232/252|c.2.1.2| HM:SCP:REP 1->247|1zemA1|3.5e-64|37.2|239/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 8425 OP:NHOMOORG 1090 OP:PATTERN 1111234555655543151221216227142611---------21132--322-21111-21523-12 CCQ3N1-4558121DOI88-8N11Jn87888ESXZYIRqk4P7nD8852521FA952311A9E1D5FKNK81---1111146J2222345441322---52G268Y6M6811111111111111443-44321452B999B222A656AB544222211-622351AA7H61111-111111188767441B7MBBCBCBDEBCCCCFBGDKKEICBD9GGIEB9666665ET755555445555554AAA6851713416-1-574444434687344434243433322222222222454455555444522211122233255A444333443553662243633116711196121224333344512819NBBF22132F7mMO457LEJIHDDEBCAEDEEM-BEFDASDHGeM1fQQGTOOiiYWTMQAG6GBNBBCGDAI88888888CLK956C92211111112-11133111-121-2111148TYE2CVPINiRVWYdGIHIIRRgkKJJJ9GlLkLmbP48HJFD3AA9ICN6XS6952637831111111235EB45A3331212-222335862C54625546DG3222221222222222222222323226678647994E532664648855434347544--13357-1----79EA4A58778888777-7797868797768888888GMHB73498467878888767678J564554711787888888888111513121776734EHD111316111111231ABDEB3C344H5CEBBBCGO9DDGDCDEG2232232222334B5455456445CDC9E8755543331141447644--------1-3----------1--------------3232143444371 11--726-1-1-266CNFDIGKCMIKE881655A88495938A555ACIHIOTU8A689A7826A-3214-1237111-124335317-AI9N7H53447532B87-494N7E56612---24243-5-A94-454112-51253132-231-51426EIEA2B88543225C394451Q1113A9FGeBM73591214 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 251 STR:RPRED 100.0 SQ:SECSTR GTccTTcEEEEETTTcHHHHHHHHHHHHTTcEEEEEEcccTTHHHHHHHHTcEEEEccTTcHHHHHHHHHHHHHHHcTcccEEEEcccccccccccccccTTTccHHHHHHHHHHHTHHHHHHHHHHHHHHGGGTcEEEEEEccGGGTcccTTcHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEEcccccccHHHHHHccHHHHHHTTcTTcccccHHHHHHHHHHHHcGGGTTccccEEEEcTTGGGc DISOP:02AL 1-2| PSIPRED cccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHccccEEEEccccccccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHccccccEEEEcccEEEc //