[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53814.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:74 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->70 PF07332 * DUF1469 4e-05 23.6 55/121  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53814.1 GT:GENE BAF53814.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(930759..930983) GB:FROM 930759 GB:TO 930983 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53814.1 LENGTH 74 SQ:AASEQ MSADKSQDQSESQRKGLQLEALLGFLGFFSFLAVIQAIINVLRPEPAVWPALLALVLVIATVSVWRAWRKRRPN GT:EXON 1|1-74:0| TM:NTM 2 TM:REGION 18->40| TM:REGION 45->66| SEG 16->32|glqleallgflgffsfl| SEG 47->62|avwpallalvlviatv| HM:PFM:NREP 1 HM:PFM:REP 16->70|PF07332|4e-05|23.6|55/121|DUF1469| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-19,72-75| PSIPRED cccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccc //