[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53827.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  860/915 : Eukaryota  28/199 : Viruses  0/175   --->[See Alignment]
c.84.1d.129.2
:458 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->448 1k2yX PDBj 1e-61 37.5 %
:RPS:PDB   14->458 3bkqX PDBj 2e-93 33.0 %
:RPS:SCOP  13->154 1k2yX1  c.84.1.1 * 2e-25 36.2 %
:RPS:SCOP  155->260 1k2yX2  c.84.1.1 * 1e-28 41.3 %
:RPS:SCOP  265->368 1k2yX3  c.84.1.1 * 1e-22 29.8 %
:RPS:SCOP  370->458 1k2yX4  d.129.2.1 * 8e-17 27.9 %
:HMM:SCOP  8->181 1kfiA1 c.84.1.1 * 2.8e-34 35.5 %
:HMM:SCOP  156->260 3pmgA2 c.84.1.1 * 3e-32 49.0 %
:HMM:SCOP  261->368 1k2yX3 c.84.1.1 * 5.7e-31 38.9 %
:HMM:SCOP  369->458 1k2yX4 d.129.2.1 * 5.5e-19 34.5 %
:RPS:PFM   16->115 PF02878 * PGM_PMM_I 9e-16 45.0 %
:RPS:PFM   159->257 PF02879 * PGM_PMM_II 8e-18 51.0 %
:RPS:PFM   265->365 PF02880 * PGM_PMM_III 3e-10 34.7 %
:HMM:PFM   12->127 PF02878 * PGM_PMM_I 1.5e-34 38.8 116/138  
:HMM:PFM   264->371 PF02880 * PGM_PMM_III 1.5e-30 36.4 107/111  
:HMM:PFM   158->257 PF02879 * PGM_PMM_II 9.9e-28 47.5 99/105  
:HMM:PFM   376->456 PF00408 * PGM_PMM_IV 1.8e-14 32.4 68/73  
:BLT:SWISS 12->439 MANB_ECOLI 3e-80 39.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53827.1 GT:GENE BAF53827.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 943369..944745 GB:FROM 943369 GB:TO 944745 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53827.1 LENGTH 458 SQ:AASEQ MRTRESVTAVIKAYDVRGVVGVDIDADFISETGAAFGRLMRGEGETTVAIGHDMRDSSPELAKAFADGVTAQGLDVVHLGLTSTDELYFASGTLKCAGAMFTASHNPAEYNGIKLCRAGARPVGQDSGLANIIDDLVEGVPAFDGEHGSVSEQDLLSAYAEYLNELVDLKNIRPLKVAVDAANGMGGFTVPEVFRGLPLDVAPLYFELDGNFPNHEANPLEPANLVDLQKFTVETGSDIGLAFDGDADRCFVVDEKGQPVSPSAICAIVAERYLEKLPGSTIIHNLITSKAVPEVIAENGGTAVRTRVGHSFIKAKMAETGAAFGGEHSAHYYFTEFFNADSGILAAMHVLAALGSQDQPLSEMMARYNRYVASGELNSRLANAEAQQERTQAVLDAFADRTESVDTLDGVTVELKDTSAWFNVRASNTEPLLRLNVEAASKEEVDALVAEILGIIRA GT:EXON 1|1-458:0| BL:SWS:NREP 1 BL:SWS:REP 12->439|MANB_ECOLI|3e-80|39.9|419/456| BL:PDB:NREP 1 BL:PDB:REP 9->448|1k2yX|1e-61|37.5|421/459| RP:PDB:NREP 1 RP:PDB:REP 14->458|3bkqX|2e-93|33.0|436/457| RP:PFM:NREP 3 RP:PFM:REP 16->115|PF02878|9e-16|45.0|100/137|PGM_PMM_I| RP:PFM:REP 159->257|PF02879|8e-18|51.0|98/103|PGM_PMM_II| RP:PFM:REP 265->365|PF02880|3e-10|34.7|101/114|PGM_PMM_III| HM:PFM:NREP 4 HM:PFM:REP 12->127|PF02878|1.5e-34|38.8|116/138|PGM_PMM_I| HM:PFM:REP 264->371|PF02880|1.5e-30|36.4|107/111|PGM_PMM_III| HM:PFM:REP 158->257|PF02879|9.9e-28|47.5|99/105|PGM_PMM_II| HM:PFM:REP 376->456|PF00408|1.8e-14|32.4|68/73|PGM_PMM_IV| GO:PFM:NREP 6 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02878|IPR005844| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF02878|IPR005844| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02879|IPR005845| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF02879|IPR005845| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02880|IPR005846| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF02880|IPR005846| RP:SCP:NREP 4 RP:SCP:REP 13->154|1k2yX1|2e-25|36.2|138/150|c.84.1.1| RP:SCP:REP 155->260|1k2yX2|1e-28|41.3|104/104|c.84.1.1| RP:SCP:REP 265->368|1k2yX3|1e-22|29.8|104/109|c.84.1.1| RP:SCP:REP 370->458|1k2yX4|8e-17|27.9|86/96|d.129.2.1| HM:SCP:REP 8->181|1kfiA1|2.8e-34|35.5|172/203|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 156->260|3pmgA2|3e-32|49.0|104/113|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 261->368|1k2yX3|5.7e-31|38.9|108/109|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 369->458|1k2yX4|5.5e-19|34.5|87/96|d.129.2.1|1/1|Phosphoglucomutase, C-terminal domain| OP:NHOMO 1927 OP:NHOMOORG 955 OP:PATTERN 11213111111111111211111143343344223222222222323212332222233331111-22 3321223222232121211-12222211111222222222234221322222223223222222221333211111111221211111222222221--222221222222222222121111112222232224242252222414432233-122222222422-4443212-2221112111222333211222222222222223122221222233112222222222111111111111111122211111111111111221111121-1113332222211222222222223333333333333233222333131123222223233313332222221112223311344322222223221221222211111223222222222333333332332-222222322121222212322212222222122122222222222221222222211----------111111111111111-122322223332222222222222222222222232223222222222222222222222222222222222222222222222222222222536333343222222223222222222222222222222232112143332121-21222-11-11111111111-12222-1-11122231312333223222-322323233232243233313222111323323323333333322212212212333333333231122222222222233222222121121-122133333332332322222222232233222222222222413323333333323333333333333332221111111---1-111-12----1---1--------1-------332222322211- ----11-----1--------------------------------------------------1--------------------------1--------------------1-----------------------------------------------1----2---------2-1111G111121234-31111---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 458 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHTTGccccEEEEcTTTccHHHHHHHHHHHHHHHHHTTccEEEEEEcccTTHHHHHHHHHHHHHTcTcEEEEEEEccHHHHHHHHHHccccEEEEEccTccTTEEEEEEEETTEEccTHHHHHHHHHHHHHHTcHHccccccEEEEcccHHHHHHHHHHHccccTccccEEEEEcTTcGGGGTHHHHHHHTTcEEEEEcccccTTcccccccTTcGGGcHHHHHHHHHTTccEEEEEcTTcccEEEEETTccEEcHHHHHHHHHHHHHHHcTTcEEEEETTccTHHHHHHHHTTcEEEEEcccHHHHHHHHHHHcccEEEcTTccEEEcTTcccccHHHHHHHHHHHHHHccccHHHHHHTTcccEEcccEEEEccTTTHHHHcHHHHHHHccccccEEEccccEEEEETTccEEEEEEEcccccEEEEEEEEccHHHHHHHHHHHHHHHHH DISOP:02AL 1-7| PSIPRED cccccccHHHcccccEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHcccEEEEEEcccccccccEEEEcccccccccHHHHHHHHHHHHcccccccccccEEEEccHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHccccEEEEEccccccccccccccccHHHHHHHHHHHHHccccEEEEEcccccEEEEEccccEEEcHHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHcccEEEEccccHHHHHHHHHcccEEEEEccccEEcccccccccHHHHHHHHHHHHHHccccHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccEEEEEEEcccccEEEEEEEcccHHHHHHHHHHHHHHHcc //