[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53832.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53832.1 GT:GENE BAF53832.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 947969..948235 GB:FROM 947969 GB:TO 948235 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53832.1 LENGTH 88 SQ:AASEQ MIGAKVWFSRSGSASLVSVLPGESYLAWVWVVDVVVDVAISEVGRLGLDICQTIKPRAVAAKQPATMKTRARRVSVFIVVHLRSAVVV GT:EXON 1|1-88:0| TM:NTM 3 TM:REGION 1->23| TM:REGION 28->50| TM:REGION 74->88| SEG 28->38|wvwvvdvvvdv| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccEEEEEccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccccHHHHHEEEEEEEEEEEEEccccc //