[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53842.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53842.1 GT:GENE BAF53842.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(959035..959418) GB:FROM 959035 GB:TO 959418 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53842.1 LENGTH 127 SQ:AASEQ MLVPIPGFAHLLYLVPDPLPQAIHARTEVPREVSVLVRVALDSAFGLRPIAHLTPKLFDAPVRAHVSARRRLGFTESADLLSCHVQLGEKSAEVCGSISMGVRRTAYAARLAESGGMWRMLNFRVLS GT:EXON 1|1-127:0| TM:NTM 1 TM:REGION 1->23| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------1-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccccccHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHccccHHHHcHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccEEEEHHHHHHHccccEEEEEEEEEcc //