[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53849.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  609/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.13a.4.6
:206 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->84 1h3lB PDBj 3e-27 72.9 %
:BLT:PDB   134->180 2h27D PDBj 7e-07 40.4 %
:RPS:PDB   29->186 3dxjF PDBj 8e-24 10.6 %
:RPS:SCOP  15->84 1h3lA  a.177.1.1 * 1e-26 72.9 %
:RPS:SCOP  116->193 1p4wA  a.4.6.2 * 1e-08 18.2 %
:HMM:SCOP  18->107 1or7A2 a.177.1.1 * 2e-21 34.8 %
:HMM:SCOP  116->186 1rp3A2 a.4.13.2 * 3.5e-14 36.6 %
:RPS:PFM   20->87 PF04542 * Sigma70_r2 2e-07 38.5 %
:RPS:PFM   132->180 PF08281 * Sigma70_r4_2 2e-07 46.9 %
:HMM:PFM   25->88 PF04542 * Sigma70_r2 1e-21 32.8 64/71  
:HMM:PFM   129->180 PF08281 * Sigma70_r4_2 4.5e-20 40.4 52/54  
:BLT:SWISS 12->192 RPOE_MYCTU 6e-63 62.4 %
:PROS 43->74|PS01063|SIGMA70_ECF

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53849.1 GT:GENE BAF53849.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 964659..965279 GB:FROM 964659 GB:TO 965279 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53849.1 LENGTH 206 SQ:AASEQ MAENRTGTVDGDALAARFEEEALPLLDQLYGGALRMTRNPADAEDLVQDTYIKAYQAFASFKPGTNLKAWLYRIMTNTYINMYRKKQRQPSQTSADEITDYQLVESQSHTSTGLESAEVEALKNLPDGKIGDAMNQLSPEYRMVVYYADVEDLAYKEIAEIMDVPLGTVMSRLHRGRKQLRGMLKEVAKEQGIGLEHPDMKKNSEA GT:EXON 1|1-206:0| BL:SWS:NREP 1 BL:SWS:REP 12->192|RPOE_MYCTU|6e-63|62.4|181/216| PROS 43->74|PS01063|SIGMA70_ECF|PDOC00814| BL:PDB:NREP 2 BL:PDB:REP 15->84|1h3lB|3e-27|72.9|70/78| BL:PDB:REP 134->180|2h27D|7e-07|40.4|47/69| RP:PDB:NREP 1 RP:PDB:REP 29->186|3dxjF|8e-24|10.6|151/349| RP:PFM:NREP 2 RP:PFM:REP 20->87|PF04542|2e-07|38.5|65/70|Sigma70_r2| RP:PFM:REP 132->180|PF08281|2e-07|46.9|49/54|Sigma70_r4_2| HM:PFM:NREP 2 HM:PFM:REP 25->88|PF04542|1e-21|32.8|64/71|Sigma70_r2| HM:PFM:REP 129->180|PF08281|4.5e-20|40.4|52/54|Sigma70_r4_2| GO:PFM:NREP 10 GO:PFM GO:0003677|"GO:DNA binding"|PF04542|IPR007627| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04542|IPR007627| GO:PFM GO:0006352|"GO:transcription initiation"|PF04542|IPR007627| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04542|IPR007627| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04542|IPR007627| GO:PFM GO:0003677|"GO:DNA binding"|PF08281|IPR013249| GO:PFM GO:0003700|"GO:transcription factor activity"|PF08281|IPR013249| GO:PFM GO:0006352|"GO:transcription initiation"|PF08281|IPR013249| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08281|IPR013249| GO:PFM GO:0016987|"GO:sigma factor activity"|PF08281|IPR013249| RP:SCP:NREP 2 RP:SCP:REP 15->84|1h3lA|1e-26|72.9|70/75|a.177.1.1| RP:SCP:REP 116->193|1p4wA|1e-08|18.2|77/87|a.4.6.2| HM:SCP:REP 18->107|1or7A2|2e-21|34.8|89/113|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 116->186|1rp3A2|3.5e-14|36.6|71/0|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 1605 OP:NHOMOORG 612 OP:PATTERN -------------------------------------------------------------------- AAF1833222232233323-24114C22222466664433322222112111333113--426143556651111111--6-1-----88E9-311---2-71589492B---------------22121111131533741117132212221111------22231111------------121---1132477777266-7673562366647773319432---11-K7--------------------2-------------------------111--------------------------------11---1111126122222221-114155-21-224--C--2267424314121-211--A-34222-1111227443233224211111111116-98D79A6A362-45546665785627233313322223222222222-2222-41------------------------------42331233235334251222244643333345262432--22223223223431431221121-------1112232-1------11----11-11-31-545588-3-------------------------11212125622312222231211121223223---1114------11111211111111111-1111111111111111111111331111111111111111111211111111-111111111111--14-----111111311111111111111111----------1211111234121321413---------11122111113133211222124441111--31112233--------1-2-------------------------1111-111113A2 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------2--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 172 STR:RPRED 83.5 SQ:SECSTR ##############HHHHHHHHHHHHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHcccTcccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcHHHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccccGGGTccccccccHHHHHHH#################### DISOP:02AL 1-8,200-207| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccHHccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHccc //