[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53854.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  47/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->72 PF11305 * DUF3107 7e-14 56.9 %
:HMM:PFM   1->73 PF11305 * DUF3107 2.6e-34 52.1 73/74  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53854.1 GT:GENE BAF53854.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 969537..969764 GB:FROM 969537 GB:TO 969764 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53854.1 LENGTH 75 SQ:AASEQ MDIKIGFADTARELVISSALQQDEAAAKVSEALANDSGVLDLSDEKGRRYIIRNSRIAYVEVGTSTPRTVGFAGA GT:EXON 1|1-75:0| RP:PFM:NREP 1 RP:PFM:REP 1->72|PF11305|7e-14|56.9|72/74|DUF3107| HM:PFM:NREP 1 HM:PFM:REP 1->73|PF11305|2.6e-34|52.1|73/74|DUF3107| OP:NHOMO 47 OP:NHOMOORG 47 OP:PATTERN -------------------------------------------------------------------- -----111111-1-11111-1111-111111-111111111-111-1----11--1-1--111-11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 74-76| PSIPRED cEEEEEEEccccEEEEEEcccHHHHHHHHHHHHcccccEEEEEccccEEEEEccccEEEEEEccccccEEEEccc //