[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53863.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:197 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   122->174 PF01863 * DUF45 1e-08 50.0 %
:HMM:PFM   91->192 PF01863 * DUF45 7e-26 35.6 101/205  
:HMM:PFM   61->115 PF09580 * Spore_YhcN_YlaJ 8e-05 27.3 55/174  
:PROS 156->165|PS00142|ZINC_PROTEASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53863.1 GT:GENE BAF53863.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 982330..982923 GB:FROM 982330 GB:TO 982923 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53863.1 LENGTH 197 SQ:AASEQ MCHLKNFPQNLIDTVTSSGLISSQLQSSVMQEKPEMPAIEVIRSAKRTKTVQARIVDGQIQVRIPARMSKAEEEKAVGEIVAKLKRRTRSAVSSDADLIERAHKLNKTVLEGRARVESIRWVSNQKGRWGSCTVATAEIRISDRLKHVPDYVLDAVLVHELTHTFIAGHSAEFWEWADKTPLAERAKGYLEAYQRWG GT:EXON 1|1-197:0| PROS 156->165|PS00142|ZINC_PROTEASE|PDOC00129| SEG 17->28|ssglissqlqss| RP:PFM:NREP 1 RP:PFM:REP 122->174|PF01863|1e-08|50.0|52/198|DUF45| HM:PFM:NREP 2 HM:PFM:REP 91->192|PF01863|7e-26|35.6|101/205|DUF45| HM:PFM:REP 61->115|PF09580|8e-05|27.3|55/174|Spore_YhcN_YlaJ| OP:NHOMO 42 OP:NHOMOORG 42 OP:PATTERN ------------------------------------------------1------------------- ----1111111111--------------------------1---11111---111111--11111111111----------------------1----------------------------------------------1-------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----11-----------------------------------1---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,27-29,197-198| PSIPRED cccHHHHHHHHHHHHHcccHHHHHHHHHHccccccccEEEEEEccccEEEEEEEEEccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccccccEEEEEHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHccccc //