[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53867.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:174 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53867.1 GT:GENE BAF53867.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(986244..986768) GB:FROM 986244 GB:TO 986768 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53867.1 LENGTH 174 SQ:AASEQ MNDSIFSPQALNKAMLEAVEFIHAEGWDAGPTLFALVPTEMLVDTLDEAADDSPLTLVVQDNLPDNLLPGSEALGDYVSRLAWPAEIAGAVLAQEIMFTDAAVAGSEPRPARLFSGVLRGEAELTLLQLRPTEEELAERGPFAEDEIELRGGPGVAPGVIAALRYTLEADPDEI GT:EXON 1|1-174:0| SEG 151->162|ggpgvapgviaa| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- -----111111111----------------------1111-------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-8,169-175| PSIPRED ccccccccHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHcHHccccccccEEccccccccccccHHHHHHHHHHHccHHHHcEEEEEEEEEEEccccccccccHHHHHHHHHccccEEEEEEEccccHHHHHHcccccccccccccccHHHHHHHHHHHHHHcccccc //