[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53876.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:74 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->63 PF02672 * CP12 0.00097 23.5 34/71  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53876.1 GT:GENE BAF53876.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(997074..997298) GB:FROM 997074 GB:TO 997298 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53876.1 LENGTH 74 SQ:AASEQ MTQIGIHADNTPYCINSVRGVVFRIEKDLRDTKLHRYSHQQGCAALVKILNSLQDEKSFNRNHVYLKATWLDHD GT:EXON 1|1-74:0| HM:PFM:NREP 1 HM:PFM:REP 30->63|PF02672|0.00097|23.5|34/71|CP12| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,73-75| PSIPRED ccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccEEEEEEEEcccc //