[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53877.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->56 PF11834 * DUF3354 0.0008 35.1 37/69  
:BLT:SWISS 15->62 RNH_WIGBR 4e-04 33.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53877.1 GT:GENE BAF53877.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(997301..997612) GB:FROM 997301 GB:TO 997612 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53877.1 LENGTH 103 SQ:AASEQ MIDMCTTPRQEILIREQFKEINNGRVVPHYDQLEQLAEIFSTKDSIDMVNEILNRDTDFLSNEGTIFMEYIFNGGFHTDNGYQPLSYAYVERALAIRPPRIVL GT:EXON 1|1-103:0| BL:SWS:NREP 1 BL:SWS:REP 15->62|RNH_WIGBR|4e-04|33.3|48/100| HM:PFM:NREP 1 HM:PFM:REP 19->56|PF11834|0.0008|35.1|37/69|DUF3354| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,4-5| PSIPRED cccccccHHHHHHHHHHHHHcccccEEccHHHHHHHHHHHcccHHHHHHHHHHHccHHHHccccEEEEEEEccccccccccccccHHHHHHHHHccccccccc //