[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53884.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  259/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:117 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->115 PF04343 * DUF488 2e-20 47.2 %
:HMM:PFM   8->115 PF04343 * DUF488 5.1e-34 44.3 106/122  
:BLT:SWISS 1->116 YEAO_ECOLI 4e-22 44.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53884.1 GT:GENE BAF53884.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1003497..1003850 GB:FROM 1003497 GB:TO 1003850 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53884.1 LENGTH 117 SQ:AASEQ MSIHIAKVHDVLKGEKTYGTTILVDRLWPRGVKKDDLEPDLWLKGVAPTIELRKWFGHDPAKFSEFSTRYTEELNASNDKDLETLVDATSRHPVTLLYGAADRDHNHAIVLAKWLKK GT:EXON 1|1-117:0| BL:SWS:NREP 1 BL:SWS:REP 1->116|YEAO_ECOLI|4e-22|44.2|113/115| RP:PFM:NREP 1 RP:PFM:REP 5->115|PF04343|2e-20|47.2|108/113|DUF488| HM:PFM:NREP 1 HM:PFM:REP 8->115|PF04343|5.1e-34|44.3|106/122|DUF488| OP:NHOMO 281 OP:NHOMOORG 273 OP:PATTERN ------1211111-11-1----------------------------1---------------11---- -1-111-111111-11111-1---11111111----1-221----11-1------1------21-1--211-11121-1---1-----1111-1--1---1--2---1----------------1--------------------------------------------------------------------------------------11------11-------------111111111111111---1111111111111111111----1-----------------------------------------------------------------------------------------1------1------------1----11------11111111111----------1---11-11111-11-1-----1-------11111111-11-------------------------------------1---11----------------------1-------------------11--11--------------111---1-1---1-1----1-111-111------1111-11-----------------1----11----1----------------------------11-1------111111-1111111111-111111111111111111111111--11111111111111111111111-1--1--------------------11111-------1-1---------111111-----111111---1111-1-----------------------------------------------------------1-------------------------------------1-1 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccEEEEEccccccccccccEEEEEEccccccccHHHHHcccccccccccHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHcc //