[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53885.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.97.1
:105 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->100 3b8fC PDBj 4e-15 40.4 %
:RPS:PDB   5->84 3b8fB PDBj 5e-04 41.2 %
:RPS:SCOP  1->88 1wn5A1  c.97.1.1 * 9e-09 26.2 %
:HMM:SCOP  1->100 2fr5A1 c.97.1.1 * 7.4e-11 27.1 %
:HMM:PFM   52->76 PF00383 * dCMP_cyt_deam_1 0.00018 32.0 25/102  
:BLT:SWISS 21->78 BSR_BACCE 8e-05 34.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53885.1 GT:GENE BAF53885.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1004360..1004677) GB:FROM 1004360 GB:TO 1004677 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53885.1 LENGTH 105 SQ:AASEQ MLLADDTVLVGTAPEVLNAGVELCRETEPFCAAYRMGQRLVTSICLARHPDGRYLVLNPCGVCRERLAIHGPGVMVAVAHPDDPTTPTWKRLKDVHLDYWVTPAV GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 21->78|BSR_BACCE|8e-05|34.5|58/100| BL:PDB:NREP 1 BL:PDB:REP 5->100|3b8fC|4e-15|40.4|94/140| RP:PDB:NREP 1 RP:PDB:REP 5->84|3b8fB|5e-04|41.2|80/142| HM:PFM:NREP 1 HM:PFM:REP 52->76|PF00383|0.00018|32.0|25/102|dCMP_cyt_deam_1| RP:SCP:NREP 1 RP:SCP:REP 1->88|1wn5A1|9e-09|26.2|84/125|c.97.1.1| HM:SCP:REP 1->100|2fr5A1|7.4e-11|27.1|96/0|c.97.1.1|1/1|Cytidine deaminase-like| OP:NHOMO 22 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- -------1--1--------------------------------------------1-------------------1----------------------------------------------------------------------1--------11-------------------------------------11111-11-111--1--11--1-----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 91.4 SQ:SECSTR ####TccEEEEcccccccGGGcccTTHHHHHHHHHHTccEEEEEEEEEccTTccEEccccHHHHHHHGGGcTTcEEEcccTTccTcTTcccTHHHcTTcG##### PSIPRED ccccccEEEEEEEcccccccccHHHHHHHHHHHHHccccEEEEEEEEcccccccccccccHHHHHHHHHHccccEEEEEcccccEEEEEEEHHHccccccccccc //