[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53889.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  263/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:420 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->419 2ghbB PDBj 3e-51 31.9 %
:RPS:PDB   47->405 1a7lC PDBj 1e-55 27.2 %
:RPS:SCOP  47->418 1a7lA  c.94.1.1 * 2e-43 24.6 %
:HMM:SCOP  26->419 1eljA_ c.94.1.1 * 2.4e-66 25.9 %
:RPS:PFM   60->335 PF01547 * SBP_bac_1 2e-08 26.3 %
:HMM:PFM   58->337 PF01547 * SBP_bac_1 2.7e-19 21.3 258/314  
:BLT:SWISS 58->400 MALE_ECOLI 6e-34 31.5 %
:PROS 312->327|PS00012|PHOSPHOPANTETHEINE
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53889.1 GT:GENE BAF53889.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1007982..1009244) GB:FROM 1007982 GB:TO 1009244 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53889.1 LENGTH 420 SQ:AASEQ MTSPRFSRRQFLGAAGLLVAGGALTACGSGGGQAAGSGALLGRPRPLTIWASQYEVPGLEKVAERFQEDTGVSIRVIQRNYNGQMLSDFLTQVPTGEGPDIIVAPHDVLGQVVNNGAVSPVDLIDPEDNFVDIALQAVTYDGRYYGVPFIIENVALLRNNAMTDHTPETFDDLLAEGHRLMDAGVAKYPFTTSQSEASGDPYHLYPIQSSFGAEVFKRDADGAYTAELGMGGDGGHAFANYLAEMGANRDLIVTMTPDISKQAFIDGESPYFIAGPWNLPDIQAADMDIEVLSVPSAGGQPAVPFVGVSSFMINANSSSPLAARDLALNYLSQPEVQLELFSNNQRPPANKEALESMGDPVLAGYARIAQEDGAPMPSIPQMGAVWNFWGITQNGIVNGADDPEQLWDTMITNIERAIES GT:EXON 1|1-420:0| BL:SWS:NREP 1 BL:SWS:REP 58->400|MALE_ECOLI|6e-34|31.5|324/396| PROS 312->327|PS00012|PHOSPHOPANTETHEINE|PDOC00012| SEG 12->42|lgaagllvaggaltacgsgggqaagsgallg| BL:PDB:NREP 1 BL:PDB:REP 47->419|2ghbB|3e-51|31.9|367/372| RP:PDB:NREP 1 RP:PDB:REP 47->405|1a7lC|1e-55|27.2|349/362| RP:PFM:NREP 1 RP:PFM:REP 60->335|PF01547|2e-08|26.3|255/282|SBP_bac_1| HM:PFM:NREP 1 HM:PFM:REP 58->337|PF01547|2.7e-19|21.3|258/314|SBP_bac_1| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF01547|IPR006059| GO:PFM GO:0006810|"GO:transport"|PF01547|IPR006059| RP:SCP:NREP 1 RP:SCP:REP 47->418|1a7lA|2e-43|24.6|362/380|c.94.1.1| HM:SCP:REP 26->419|1eljA_|2.4e-66|25.9|363/380|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 346 OP:NHOMOORG 276 OP:PATTERN --1-------------2-11----1--1--1-----------------------11-111-------- ----3--1--1---------------------------------133111--1-2-1------12--1--1-----------1-----------------------------------------------------222-----1----------------------11--------------1111122-11-11111-111111111322212111111-121234333-2-11111111111111------1---1--11111----------1111111222-1111111-1111111111111111111--------11-----------1----11-1111------1--------3---11111----------------------------------------------------111--121111---------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------121----------------------------------------12-111-1111111111-11111111111111111112221111-11111111111111111---1111--122222222222---------------2--111221-----1-----------------------1----1--------------1131111111322----------------------------------1-------------------------1121121222--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 378 STR:RPRED 90.0 SQ:SECSTR ##########################################cccEEEEEccTccHHHHHHHHHHHHHHHcccEEEEccTccTTHHHHHHHHGGGTccccEEEEEGGGHHHHHHTTcccccccHHHHTTccHHHHHHTEETTEEccEEEEEEccEEEEETTTccccccccTTHHHHHHHHHTTTccccccccccHHEcccHHHHHHHHHHTTcEEEEEccccEEEEEEETTcHHHHHHHHHHHHHHHTTcccTTccHHHHHHHHHTTcccEEEEcGGGHHHHHHHTccEEEEcccccTTcccccEEEEEEEEEcTTcTTHHHHHHHHHHTTccHHHHHHHHHHccccEEccHHHHHTTcHHHHHHHHHHHHHcEEccccTTHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHcHHccH DISOP:02AL 1-4,29-43,420-421| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHcccccccccccccccccHHHHHHEEEccEEEEEEEEEccEEEEEEHHHcccccccHHHHHHHHHHHHccccccEEEccccccccccHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccEEEEEEcHHHHHHHHcccccEEEEEccccccccccEEEEEEEEEEEcccccHHHHHHHHHHHHccHHHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcc //