[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53908.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  231/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:127 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->66 1g6pA PDBj 8e-12 39.7 %
:RPS:PDB   1->65 1c9oA PDBj 5e-15 38.5 %
:RPS:SCOP  1->65 1c9oA  b.40.4.5 * 3e-15 38.5 %
:HMM:SCOP  1->66 2es2A1 b.40.4.5 * 2.8e-16 42.4 %
:RPS:PFM   4->65 PF00313 * CSD 6e-10 46.8 %
:HMM:PFM   2->62 PF00313 * CSD 8.5e-17 41.0 61/67  
:BLT:SWISS 1->62 CSPA_STRP8 3e-12 45.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53908.1 GT:GENE BAF53908.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1033490..1033873 GB:FROM 1033490 GB:TO 1033873 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53908.1 LENGTH 127 SQ:AASEQ MPVGTVKWYDAERGFGFVSNPGGEDCFVGKQVLPKGVTELHKGQRIDFDFAAGRKGPQALRIKILETPRRRPQHKYKPEELNGMISDLITLLESGVQPGLAKGQYPEHKAGAQVAEILRVVAKELES GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 1->62|CSPA_STRP8|3e-12|45.2|62/67| BL:PDB:NREP 1 BL:PDB:REP 4->66|1g6pA|8e-12|39.7|63/66| RP:PDB:NREP 1 RP:PDB:REP 1->65|1c9oA|5e-15|38.5|65/66| RP:PFM:NREP 1 RP:PFM:REP 4->65|PF00313|6e-10|46.8|62/67|CSD| HM:PFM:NREP 1 HM:PFM:REP 2->62|PF00313|8.5e-17|41.0|61/67|CSD| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF00313|IPR002059| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00313|IPR002059| RP:SCP:NREP 1 RP:SCP:REP 1->65|1c9oA|3e-15|38.5|65/66|b.40.4.5| HM:SCP:REP 1->66|2es2A1|2.8e-16|42.4|66/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 371 OP:NHOMOORG 233 OP:PATTERN -------------------------------------------------------------------1 2---411211112111111-1211111111112222321133343211111122211311552134378511111111----1-------------------------------------------------------------------------------------------------------11---1113333333343333331-11-1334---213122222253-11111111111111111121----------------1----1-231111111--------------1111111111111---111---3-21-11111111-1-1233211-1-----------12-----------1-------------------------------------------1-1-------------------------------------------1---------------------------------------111--------------------------------------------------------------------1--2-------------------1111--31-------------------------------------1-1111------1----1---1-----------------------------------------------------------------------------------------------------------1-------------------12--2-1----1----------------------------11-11111---11--------------11--------------------------------------------22-11111-1--- ----------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 60.6 SQ:SECSTR cEEEEEEEEETTTTEEEEEETTEEEEEEGGGccccccccccTTcEEEEEEEEETTEEEEEEEEEcEEETTccccccc################################################## DISOP:02AL 1-1,64-80,126-128| PSIPRED ccccEEEEEEccccEEEEEcccccEEEEEEHHHHccccccccccEEEEEEEEcccccEEEEEEEcccccccHHHcccHHHHHHHHHHHHHHHHHccccHHHHcccccHHHHHHHHHHHHHHHHHHcc //