[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53909.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:175 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   50->145 1ah5A PDBj 2e-04 29.2 %
:RPS:PFM   43->172 PF10969 * DUF2771 3e-20 48.0 %
:HMM:PFM   14->173 PF10969 * DUF2771 2.8e-58 40.6 155/161  
:BLT:SWISS 43->160 Y899_MYCBO 1e-06 32.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53909.1 GT:GENE BAF53909.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1033928..1034455) GB:FROM 1033928 GB:TO 1034455 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53909.1 LENGTH 175 SQ:AASEQ MASRKTKRKNLIQILSLIVAVLLVVILSVVFQQWWNNRPEPLPQEISISASSPAGEIEVFPFSMCEPGVECEENEVPTLEVGADEELHLTIPEAIHDHDWYLLTIYDDPAANDEFYHTSYDATEATVPGSVDPTEEGAERPRLVVVEVSAVMIGEDENGEESPYTVTWSLSTMNE GT:EXON 1|1-175:0| BL:SWS:NREP 1 BL:SWS:REP 43->160|Y899_MYCBO|1e-06|32.4|111/162| TM:NTM 1 TM:REGION 11->33| SEG 11->30|liqilslivavllvvilsvv| BL:PDB:NREP 1 BL:PDB:REP 50->145|1ah5A|2e-04|29.2|96/294| RP:PFM:NREP 1 RP:PFM:REP 43->172|PF10969|3e-20|48.0|125/162|DUF2771| HM:PFM:NREP 1 HM:PFM:REP 14->173|PF10969|2.8e-58|40.6|155/161|DUF2771| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -----111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 54.9 SQ:SECSTR #################################################HHcTTcEEEEEEccTTcccTTTHHHHHHHHTTcccEEEEEGGccccccTTEEEEEEcccccccEEEEEccccccTTccTTcEEEcccHHHcTTcEE############################## DISOP:02AL 1-9,174-176| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEccccccccccccEEEEEEcccEEEEEEEEEEccccccHHHcccccEEccccccEEEEccHHHHccccEEEEEEEcccccccEEEcccccEEEEccccccccccccccccEEEEEEEEEEEEEcccccccccEEEEEEHHccc //