[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53925.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:118 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53925.1 GT:GENE BAF53925.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1059253..1059609 GB:FROM 1059253 GB:TO 1059609 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53925.1 LENGTH 118 SQ:AASEQ MKLLKFAAAGTFALALAGCTQTESLVATIESATSAAQASGNDVEGDQTSAFELSVGECFNDTYEEEISEVPIVDCAEPHDNEIYYLYDIEGDDFPTDITTTGYEGCLPAFEGFRWCSI GT:EXON 1|1-118:0| TM:NTM 1 TM:REGION 1->20| SEG 2->18|kllkfaaagtfalalag| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,32-45| PSIPRED ccEEEEEcccEEEEEEccccccHHHHHHHHHHHHHHHcccccccccccEEEEEEHHHHHcHHHHHHHHccccEEccccccccEEEEEEEcccccccccccccccccHHHccccEEccc //