[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53938.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  200/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:136 amino acids
:PSIPRED
:RPS:PFM   6->54 PF03733 * DUF307 8e-09 53.1 %
:HMM:PFM   3->54 PF03733 * DUF307 5.5e-22 46.2 52/53  
:HMM:PFM   68->119 PF03733 * DUF307 5.9e-20 51.9 52/53  
:BLT:SWISS 4->57 YCCF_SHIFL 5e-13 53.7 %
:TM
:REPEAT 2|6->56|70->120
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53938.1 GT:GENE BAF53938.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1069940..1070350 GB:FROM 1069940 GB:TO 1070350 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53938.1 LENGTH 136 SQ:AASEQ MRLILNLIWLFFGGIWLALGYVFFGIIACIFIVTIPAGIASFRMANYALWPFGRTVVRNPKAGGFSALSNGLWFIIAGLWLAIGHLTTAAAQAITIIGIPLAIANIRMIPVTCFPFGKEIYDSNRIPFGYEPMVKF GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 4->57|YCCF_SHIFL|5e-13|53.7|54/148| TM:NTM 3 TM:REGION 10->32| TM:REGION 68->90| TM:REGION 96->118| NREPEAT 1 REPEAT 2|6->56|70->120| SEG 87->99|ttaaaqaitiigi| RP:PFM:NREP 1 RP:PFM:REP 6->54|PF03733|8e-09|53.1|49/53|DUF307| HM:PFM:NREP 2 HM:PFM:REP 3->54|PF03733|5.5e-22|46.2|52/53|DUF307| HM:PFM:REP 68->119|PF03733|5.9e-20|51.9|52/53|DUF307| OP:NHOMO 201 OP:NHOMOORG 201 OP:PATTERN -------------------------------------------------------------------- ----1111111----1111-11--1111111111111111-111-11-1---111--1--11--1111111111111---1-------1111-1-------------1-1---------------------------------------1-------1--1----1--------------------------------------------------------------------------------------------------------1-----------1111-11------------------1--------------1------------1-1-----111--1-------11-------------------11--------111--11-11------------------------------------------------------------------------------------------------------------------------------------111-----------------------------------------------11-11----------------------------------------------111--------1111111111111111111-------------111-1111111111111-111111111111111111111111----1--------------11111111--111111111111---1-----------------1-1--------1---------------------------------------111-1111111111----------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHcccccccccccccccc //