[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53943.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   61->94 PF11145 * DUF2921 0.00099 35.3 34/962  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53943.1 GT:GENE BAF53943.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1075393..1075776 GB:FROM 1075393 GB:TO 1075776 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53943.1 LENGTH 127 SQ:AASEQ MDNLSELSASHAQQNSSEGRAFLADLFTELVDDCYFSGVHETCSARAHACFSDGLGNLRATFHRIEDFAVQAVDLLAILLDLRIGQWVIRARRHPDLEVVTCISHAHYSATSGCRLCVSTPPSRLLG GT:EXON 1|1-127:0| HM:PFM:NREP 1 HM:PFM:REP 61->94|PF11145|0.00099|35.3|34/962|DUF2921| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-20,127-128| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcHHHcccccccEEEEcccHHHHcc //