[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53947.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:169 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->122 1yg2A PDBj 7e-05 25.5 %
:RPS:SCOP  2->169 1yg2A  a.4.5.61 * 9e-07 17.8 %
:HMM:SCOP  2->166 1yg2A_ a.4.5.61 * 5.6e-18 27.6 %
:RPS:PFM   6->77 PF03551 * PadR 8e-04 32.4 %
:HMM:PFM   5->82 PF03551 * PadR 4e-09 26.0 77/86  
:BLT:SWISS 50->119 SSA1_PASHA 1e-04 33.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53947.1 GT:GENE BAF53947.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1080927..1081436) GB:FROM 1080927 GB:TO 1081436 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53947.1 LENGTH 169 SQ:AASEQ MSIKHALLVLMLDEPTSASQLQTKFEETMGIWQLNIGQVTQTIQRLQRDGLAETAGTTVSSNGRTVDTFQPTDLGRELVAQWFESPVTVTLSERDELVTKIAIAESRGLNLIPLLDIQRNTVMAELRALNKSSRDLPETRNTQRLLVEKRIFELEAQARWLDRIEALDK GT:EXON 1|1-169:0| BL:SWS:NREP 1 BL:SWS:REP 50->119|SSA1_PASHA|1e-04|33.3|69/100| BL:PDB:NREP 1 BL:PDB:REP 2->122|1yg2A|7e-05|25.5|110/169| RP:PFM:NREP 1 RP:PFM:REP 6->77|PF03551|8e-04|32.4|71/84|PadR| HM:PFM:NREP 1 HM:PFM:REP 5->82|PF03551|4e-09|26.0|77/86|PadR| RP:SCP:NREP 1 RP:SCP:REP 2->169|1yg2A|9e-07|17.8|157/169|a.4.5.61| HM:SCP:REP 2->166|1yg2A_|5.6e-18|27.6|163/0|a.4.5.61|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 24 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ----21-1111--------------------------------1-11-----111--1-----1111212-----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 110 STR:RPRED 65.1 SQ:SECSTR #cHHHHHHHHHHHccccHHHHHHHHTTGGGTccccHHHHHHHHHHHHHTTcEEEc##########cccEEEcHHHHHHHHHHHHcc#ccccccccHHHHHTccHHHHHHHHHHHHHHHHHHH############################################### DISOP:02AL 59-62| PSIPRED ccHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHcccEEEEEEEccccccccEEEEEcHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHc //