[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53956.1
DDBJ      :             hypothetical protein
Swiss-Prot:RS14_CORGB   RecName: Full=30S ribosomal protein S14;

Homologs  Archaea  0/68 : Bacteria  642/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.39.1
:101 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->101 3e1aG PDBj 9e-19 45.8 %
:RPS:PDB   2->101 3bbnN PDBj 9e-23 35.4 %
:RPS:SCOP  2->101 1vs5N1  g.39.1.7 * 8e-21 43.8 %
:HMM:SCOP  42->101 1fjgN_ g.39.1.7 * 9.8e-20 56.7 %
:RPS:PFM   68->100 PF00253 * Ribosomal_S14 3e-07 63.6 %
:HMM:PFM   47->100 PF00253 * Ribosomal_S14 7.4e-23 50.0 54/55  
:HMM:PFM   6->44 PF04978 * DUF664 0.00048 17.9 39/150  
:BLT:SWISS 1->101 RS14_CORGB 1e-46 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53956.1 GT:GENE BAF53956.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1088972..1089277) GB:FROM 1088972 GB:TO 1089277 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53956.1 LENGTH 101 SQ:AASEQ MAKKSKIAKNEKRKEIVARYAERRAELKAIIRNPNTSDEDRLDAQFELNSQPRDAAAVRVRNRDSHDGRPRGYLRKFGLSRVRMREMAHRGELPGVRKSSW GT:EXON 1|1-101:0| SW:ID RS14_CORGB SW:DE RecName: Full=30S ribosomal protein S14; SW:GN Name=rpsN; OrderedLocusNames=cgR_0981; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->101|RS14_CORGB|1e-46|100.0|101/101| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| SEG 53->64|rdaaavrvrnrd| BL:PDB:NREP 1 BL:PDB:REP 2->101|3e1aG|9e-19|45.8|96/96| RP:PDB:NREP 1 RP:PDB:REP 2->101|3bbnN|9e-23|35.4|99/99| RP:PFM:NREP 1 RP:PFM:REP 68->100|PF00253|3e-07|63.6|33/55|Ribosomal_S14| HM:PFM:NREP 2 HM:PFM:REP 47->100|PF00253|7.4e-23|50.0|54/55|Ribosomal_S14| HM:PFM:REP 6->44|PF04978|0.00048|17.9|39/150|DUF664| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00253|IPR001209| GO:PFM GO:0005622|"GO:intracellular"|PF00253|IPR001209| GO:PFM GO:0005840|"GO:ribosome"|PF00253|IPR001209| GO:PFM GO:0006412|"GO:translation"|PF00253|IPR001209| RP:SCP:NREP 1 RP:SCP:REP 2->101|1vs5N1|8e-21|43.8|96/96|g.39.1.7| HM:SCP:REP 42->101|1fjgN_|9.8e-20|56.7|60/60|g.39.1.7|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 663 OP:NHOMOORG 642 OP:PATTERN -------------------------------------------------------------------- -----11111111111222-2111212222121---1211----1-1-21111111111111112-12221----1------------111111--11-11111-111-111111111111111111111111111----------11111111111111111111-111-1111-1-1-11-1-1--111--1---------------1-1111-------111111111---1111111111111-111112-1-22-11-11111221111111--1111111---111111111111111111111111-11---1111------------------------------------1-1---------111--1111-1111111-11--1111-1111111111111111111111-1111111111111111-1111111111111111111-1111111111111111111111111111-11-11111111111111111111111111111111111111111111111111----111111111111111-11111111111-------1---111--------------1------------------------------1111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111-----11-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------------11111--------------------------------11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 99.0 SQ:SECSTR #ccTTHHHHHHTTTccTTTTcccTTTTTTTTccccccccccccHHHHcccccccccGGGcccccccccccccccTTTcccTTHHHHHHTTTcccccccccc DISOP:02AL 1-2,101-102| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHEEcccccEEEccccHHHHHHHHHHHcccccccccccc //