[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53961.1
DDBJ      :             hypothetical protein
Swiss-Prot:RL31B_CORGL  RecName: Full=50S ribosomal protein L31 type B;

Homologs  Archaea  0/68 : Bacteria  563/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
d.325.1
:88 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   44->87 1yl34 PDBj 5e-11 59.1 %
:RPS:PDB   2->86 3bbo1 PDBj 8e-21 35.2 %
:RPS:SCOP  1->84 1vs6Z1  d.325.1.2 * 2e-23 41.4 %
:HMM:SCOP  1->84 1vs6Z1 d.325.1.2 * 1.6e-22 50.0 %
:RPS:PFM   1->79 PF01197 * Ribosomal_L31 3e-20 62.7 %
:HMM:PFM   1->79 PF01197 * Ribosomal_L31 1.2e-33 64.2 67/69  
:BLT:SWISS 1->88 RL31B_CORGL 3e-49 100.0 %
:PROS 49->70|PS01143|RIBOSOMAL_L31

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53961.1 GT:GENE BAF53961.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1092024..1092290 GB:FROM 1092024 GB:TO 1092290 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53961.1 LENGTH 88 SQ:AASEQ MKKDIHPDYHAVVFQDAGTGFQFLTKSTASSDRTVSWEDGNEYPLIVVDVTSESHPFWTGAQRVMDTAGRVEKFERRFGGMARRKKKA GT:EXON 1|1-88:0| SW:ID RL31B_CORGL SW:DE RecName: Full=50S ribosomal protein L31 type B; SW:GN Name=rpmE2; Synonyms=rpmE; OrderedLocusNames=Cgl0872, cg0994; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->88|RL31B_CORGL|3e-49|100.0|88/88| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 49->70|PS01143|RIBOSOMAL_L31|PDOC00880| BL:PDB:NREP 1 BL:PDB:REP 44->87|1yl34|5e-11|59.1|44/73| RP:PDB:NREP 1 RP:PDB:REP 2->86|3bbo1|8e-21|35.2|71/72| RP:PFM:NREP 1 RP:PFM:REP 1->79|PF01197|3e-20|62.7|67/69|Ribosomal_L31| HM:PFM:NREP 1 HM:PFM:REP 1->79|PF01197|1.2e-33|64.2|67/69|Ribosomal_L31| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01197|IPR002150| GO:PFM GO:0005622|"GO:intracellular"|PF01197|IPR002150| GO:PFM GO:0005840|"GO:ribosome"|PF01197|IPR002150| GO:PFM GO:0006412|"GO:translation"|PF01197|IPR002150| RP:SCP:NREP 1 RP:SCP:REP 1->84|1vs6Z1|2e-23|41.4|70/70|d.325.1.2| HM:SCP:REP 1->84|1vs6Z1|1.6e-22|50.0|70/0|d.325.1.2|1/1|L28p-like| OP:NHOMO 628 OP:NHOMOORG 568 OP:PATTERN -------------------------------------------------------------------- ---1211111111121211-111122111112211122111-----12-1111111111111-211233311222211----1-----111111111--11111111111111111111111111-1111111111-----------------------------------------------11-----11-111111111111111-1111111-1----111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111---------------1---1-------1--------------------111--------1--111-11111111111111111111-----------1-111111-11111111-1--1-----1111111111111111-1-----------------------------11111-111111111111111111111111111111111111111111111111111-11111122222221-11111--1--1-----------1----------------11--------------------1121111--1-11-------11111--111----11111--1---11-1-111231111111-211111211121111-11-11111111111111111111111111--------1111111-1111-------------1---1111-1-1----1--122222221111-222222111111111-11111111111211-2222222222111111111111111-1-------11111111--1-----------------------------------111 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------1--1-1----------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 90.9 SQ:SECSTR ccTTTcccccHHHHHcccccTTTcccccccccc#######ccccccccccccccccccccccccccccccccccccccccccccccc# DISOP:02AL 1-1,79-89| PSIPRED ccccccccEEEEEEEEcccccEEEEEEEEccccEEEEEEcccccEEEEEEcccccccccccEEEEEccccHHHHHHHHHHHHHHHccc //