[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53962.1
DDBJ      :             hypothetical protein
Swiss-Prot:RL32_CORGL   RecName: Full=50S ribosomal protein L32;

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.41.8
:57 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  2->38 2i2t01 g.41.8.5 * 0.00012 29.7 %
:HMM:PFM   2->46 PF01783 * Ribosomal_L32p 4.8e-15 36.4 44/56  
:BLT:SWISS 1->57 RL32_CORGL 3e-19 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53962.1 GT:GENE BAF53962.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1092302..1092475 GB:FROM 1092302 GB:TO 1092475 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53962.1 LENGTH 57 SQ:AASEQ MAVPKRRMSRANTRMRRSQWKADNVALQEVKIDGQTVRIPRRLVKAAQLGLVDVEQF GT:EXON 1|1-57:0| SW:ID RL32_CORGL SW:DE RecName: Full=50S ribosomal protein L32; SW:GN Name=rpmF; OrderedLocusNames=Cgl0873, cg0995; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->57|RL32_CORGL|3e-19|100.0|57/57| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| SEG 6->18|rrmsrantrmrrs| HM:PFM:NREP 1 HM:PFM:REP 2->46|PF01783|4.8e-15|36.4|44/56|Ribosomal_L32p| HM:SCP:REP 2->38|2i2t01|0.00012|29.7|37/0|g.41.8.5|1/1|Zn-binding ribosomal proteins| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -----111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-20| PSIPRED ccccHHHHHHHHHHHHHHHHccccccEEEEEEccEEEEccHHHHHHHHHccccHHHc //