[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53969.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.85.1
:217 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   46->105 4ameA PDBj 1e-05 17.5 %
:RPS:SCOP  46->105 1vliA1  b.85.1.1 * 3e-07 6.7 %
:HMM:PFM   45->101 PF08666 * SAF 6.7e-11 23.2 56/63  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53969.1 GT:GENE BAF53969.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1097606..1098259) GB:FROM 1097606 GB:TO 1098259 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53969.1 LENGTH 217 SQ:AASEQ MDLKKTFTTPSWRRTLVLRRIIAFILIGIAGLLMAHSWLKKDPTAVVIVQEIPAGTKVESSDLGLQAIPTSLLPSTSYDSIDDVVGLVAASTLSSGEIATKPRFVGTELINSIVTNVTDGSLVEEINMVPLSLAEPSVIPLLQHGDTISVVSQDPDTGLPENIAAGGTVILAGGTNPSTILIALPQSIAEKVAAQSLNTPLAVVLTGDRADNYTTAE GT:EXON 1|1-217:0| SEG 18->33|lrriiafiligiagll| RP:PDB:NREP 1 RP:PDB:REP 46->105|4ameA|1e-05|17.5|57/66| HM:PFM:NREP 1 HM:PFM:REP 45->101|PF08666|6.7e-11|23.2|56/63|SAF| RP:SCP:NREP 1 RP:SCP:REP 46->105|1vliA1|3e-07|6.7|60/72|b.85.1.1| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -----111111--------------1--------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 63 STR:RPRED 29.0 SQ:SECSTR ##########################################cEEEEEcccccTTccccGGGEEEEcccccccc###GGGHHHHTTcEEcccccTTccccGGGEEccc############################################################################################################# DISOP:02AL 1-2,211-218| PSIPRED cccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEcccccEEccccEEEEEEccccccccccccHHHHHHHHHHcccccccccccHHHccHHHHHHcccccccccccccEEEEEEEcccHHHHEEEccccEEEEEccccccccccccccccEEEEEcccccEEEEEEccHHHHHHHHHHHccccEEEEEccHHcccccccc //