[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53974.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:337 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   210->279 PF03706 * UPF0104 5.6e-05 22.4 67/294  
:HMM:PFM   104->190 PF06889 * DUF1266 0.00048 21.8 87/234  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53974.1 GT:GENE BAF53974.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1101940..1102953 GB:FROM 1101940 GB:TO 1102953 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53974.1 LENGTH 337 SQ:AASEQ MSGILVIGLIVVVWLVVLAPLLLRGQKPIAKAGEAFDDTRVISEGGSNIPSPRRPGLSSAQLDDEEDTDDVDDDYEIVDSPSIFRPRKEEPVEEDLDTDVELEEDIEVSLETDDYVEPAPVVEVSQEWNVEDHYELDDSYDTPLDHLHPAARARAYEDFQEHQPEQQPEVEEFDADDELTEEDVAFAQRRRGRGYYDPEADREFAASQYVRRQRTLLGLAATVVISVILGFVFGGWVWGLPAVALAATALYLMALRSQVREENALRARRIRRLRRSRMGVRNSEDLPSRLRRPGAVVLELDDESPDFEGLPTVAMPEEPYYEEPRRNIRHLGQRRVS GT:EXON 1|1-337:0| TM:NTM 2 TM:REGION 8->30| TM:REGION 226->248| SEG 4->23|ilviglivvvwlvvlaplll| SEG 63->79|ddeedtddvdddyeivd| SEG 89->108|eepveedldtdveleediev| SEG 157->174|edfqehqpeqqpeveefd| SEG 240->255|lpavalaatalylmal| SEG 260->283|reenalrarrirrlrrsrmgvrns| SEG 316->324|peepyyeep| HM:PFM:NREP 2 HM:PFM:REP 210->279|PF03706|5.6e-05|22.4|67/294|UPF0104| HM:PFM:REP 104->190|PF06889|0.00048|21.8|87/234|DUF1266| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -----1-1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,45-62,163-194,333-338| PSIPRED cccHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccEEEEcccccccccccccccccccccccccccccccccccccccccHHHHHccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccHHHccccEEEEEEcccccccccccEEccccccccccHHHHHHHHHHHccc //