[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53987.1
DDBJ      :             hypothetical protein
Swiss-Prot:KSGA_CORGB   RecName: Full=Dimethyladenosine transferase;         EC=2.1.1.-;AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase;AltName: Full=16S rRNA dimethylase;AltName: Full=High level kasugamycin resistance protein ksgA;AltName: Full=Kasugamycin dimethyltransferase;

Homologs  Archaea  51/68 : Bacteria  901/915 : Eukaryota  189/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:293 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->283 3fuxC PDBj 4e-36 38.1 %
:RPS:PDB   31->284 2aztA PDBj 7e-15 9.1 %
:RPS:SCOP  32->290 1qyrA  c.66.1.24 * 2e-53 35.1 %
:HMM:SCOP  24->294 1i4wA_ c.66.1.24 * 1.8e-67 39.3 %
:RPS:PFM   28->283 PF00398 * RrnaAD 2e-47 49.2 %
:HMM:PFM   27->287 PF00398 * RrnaAD 1.4e-50 29.1 254/262  
:BLT:SWISS 1->293 KSGA_CORGB e-165 100.0 %
:PROS 56->83|PS01131|RRNA_A_DIMETH

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53987.1 GT:GENE BAF53987.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1118194..1119075 GB:FROM 1118194 GB:TO 1119075 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53987.1 LENGTH 293 SQ:AASEQ MEEPSGAQLLGPVEIRALAEKLDVTPTKKLGQNFVHDPNTVRRIVAAAELTPDDHVVEVGPGLGSLTLALVESAASVTAVEIDPRLAAELPETFQWRAPALAHKLSIVLKDALKVQQSDMEVQPTALVANLPYNVSVPVLLHMLEEFPTINKVLVMVQAEVADRLAADPGSKIYGVPSVKASFYGPVTRAGSIGKNVFWPAPKIESGLVKIVREDTAWKQDDETRKKVWPIIDAAFLQRRKTLRAALSGHYGSGQAAEEALRAADIDPTLRGEKLDVTDYVRLAGVLQQKDEK GT:EXON 1|1-293:0| SW:ID KSGA_CORGB SW:DE RecName: Full=Dimethyladenosine transferase; EC=2.1.1.-;AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase;AltName: Full=16S rRNA dimethylase;AltName: Full=High level kasugamycin resistance protein ksgA;AltName: Full=Kasugamycin dimethyltransferase; SW:GN Name=ksgA; OrderedLocusNames=cgR_1011; SW:KW Antibiotic resistance; Complete proteome; Methyltransferase;RNA-binding; rRNA processing; S-adenosyl-L-methionine; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->293|KSGA_CORGB|e-165|100.0|293/293| GO:SWS:NREP 5 GO:SWS GO:0046677|"GO:response to antibiotic"|Antibiotic resistance| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0006364|"GO:rRNA processing"|rRNA processing| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 56->83|PS01131|RRNA_A_DIMETH|PDOC00871| BL:PDB:NREP 1 BL:PDB:REP 9->283|3fuxC|4e-36|38.1|260/265| RP:PDB:NREP 1 RP:PDB:REP 31->284|2aztA|7e-15|9.1|243/276| RP:PFM:NREP 1 RP:PFM:REP 28->283|PF00398|2e-47|49.2|244/256|RrnaAD| HM:PFM:NREP 1 HM:PFM:REP 27->287|PF00398|1.4e-50|29.1|254/262|RrnaAD| GO:PFM:NREP 3 GO:PFM GO:0000154|"GO:rRNA modification"|PF00398|IPR001737| GO:PFM GO:0000179|"GO:rRNA (adenine-N6,N6-)-dimethyltransferase activity"|PF00398|IPR001737| GO:PFM GO:0008649|"GO:rRNA methyltransferase activity"|PF00398|IPR001737| RP:SCP:NREP 1 RP:SCP:REP 32->290|1qyrA|2e-53|35.1|248/252|c.66.1.24| HM:SCP:REP 24->294|1i4wA_|1.8e-67|39.3|257/0|c.66.1.24|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1272 OP:NHOMOORG 1141 OP:PATTERN --1111----------1111111111111111111111111111111111111111111111-----1 1111211111111211111-111111111111111111111111111111111111111112111121211111111111111-111111111111-1-11111111111111111111111111111111111111111111111111111111111111111111111111111-11111-1111111-11111111111111111122111111111111111111111111111111121111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111-1111111111111-111111111111111111 22-1211-411122111111111111111111111111111111111111111111111111111111111111111-1111111111-1211111111111122212-2432223-122112222121282-2222-123123112222212322222--221121423142222122F2221232331322232223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 284 STR:RPRED 96.9 SQ:SECSTR ######HHHccccHHHHHEcccEEcHHTccTccccccHHHHHHHHHHHHHTTccEEEEcccTTcHHHHHHHHHTcEEEEEEccHHHHHHHHHHHHHHHHHHHTTTcHHHHHcEEEEccGGGHHHHccccccEEEEEEccccGGGccccccccHHHHHHHHHHHHTEEEEEEEEEEEEcHHHHHHHTccccccccccccccccEEEEEEEEETTEEEEEEEEEEccccEEEEEEEEccccHHHHHHHHHHHHHTTcEEEEEccEETTEEccTTccccccEEEEEEEEEEEE### DISOP:02AL 1-10,290-294| PSIPRED cccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHccEEEEEEccHHHHHHHHHHHHHHcccccccEEEEEccHHccccHHcccccEEEEEccccHHHHHHHHHHHHccccccEEEEEEHHHHHHHHHcccccHHHHHHHHHHHHHHcccEEEEEcccccccccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccc //