[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53991.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->145 3eytD PDBj 7e-32 52.6 %
:RPS:PDB   7->142 3c73A PDBj 2e-11 25.0 %
:RPS:SCOP  26->139 2cv4A1  c.47.1.10 * 1e-11 15.0 %
:HMM:SCOP  7->155 2f8aA1 c.47.1.10 * 1.4e-20 23.0 %
:RPS:PFM   5->133 PF08534 * Redoxin 9e-06 30.4 %
:HMM:PFM   6->135 PF00578 * AhpC-TSA 6.4e-11 25.0 116/124  
:BLT:SWISS 1->142 DIPZ_MYCTU 6e-09 29.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53991.1 GT:GENE BAF53991.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1122678..1123160) GB:FROM 1122678 GB:TO 1123160 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53991.1 LENGTH 160 SQ:AASEQ MSSLDNAPLLELDVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGLHSVFEHHDVMTPEALKVFISEFGIKFPVAVDMPREGQRIPSTMKKYRLEGTPSIILADRKGRIRQVQFGQVDDFVLGLLLGSLLSETDET GT:EXON 1|1-160:0| BL:SWS:NREP 1 BL:SWS:REP 1->142|DIPZ_MYCTU|6e-09|29.3|133/695| SEG 146->155|lglllgslls| BL:PDB:NREP 1 BL:PDB:REP 6->145|3eytD|7e-32|52.6|133/148| RP:PDB:NREP 1 RP:PDB:REP 7->142|3c73A|2e-11|25.0|120/136| RP:PFM:NREP 1 RP:PFM:REP 5->133|PF08534|9e-06|30.4|112/132|Redoxin| HM:PFM:NREP 1 HM:PFM:REP 6->135|PF00578|6.4e-11|25.0|116/124|AhpC-TSA| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08534|IPR013740| RP:SCP:NREP 1 RP:SCP:REP 26->139|2cv4A1|1e-11|15.0|113/150|c.47.1.10| HM:SCP:REP 7->155|2f8aA1|1.4e-20|23.0|148/0|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------1 -------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---111-------------------------------------------------------1------------------------------------------------11--11---------------11---------------------11----1--1--------------111-------------------------------------------------------------------------1-----------------1---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 90.6 SQ:SECSTR ccccccccccEEEcTEcTTccEEEGGGGTTcEEEEEEEcTTcHHHHHHHHHHHHHHHHHHGGGTEEEEEEEEccccTTTccHHHHHHHHHHTTccccEEEcTTcHHHHHcHHHHHTTcccccEEEEEcTTccEEEEEcccccccH############### DISOP:02AL 1-3,156-161| PSIPRED cccccccccccccccccccccEEEHHHHcccEEEEEEEccccccHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHccccccEEEEEccccEEEEEEEccccHHHHHHHHHHHHcccccc //