[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53996.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  386/915 : Eukaryota  187/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:339 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->329 3ju1B PDBj 4e-23 36.0 %
:RPS:PDB   9->336 3bptA PDBj 9e-36 26.6 %
:RPS:SCOP  2->326 1wdkA4  c.14.1.3 * 2e-35 15.1 %
:HMM:SCOP  1->321 1wdkA4 c.14.1.3 * 1.1e-58 31.8 %
:RPS:PFM   16->186 PF00378 * ECH 3e-18 33.5 %
:HMM:PFM   16->186 PF00378 * ECH 3.9e-31 28.1 167/170  
:BLT:SWISS 14->335 HIBCH_XENTR 4e-43 34.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53996.1 GT:GENE BAF53996.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1126357..1127376 GB:FROM 1126357 GB:TO 1127376 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53996.1 LENGTH 339 SQ:AASEQ MSNVVNTFVQNSTGMVELNRPKALNSLNQEMIDLVQEALTTWADDDQVQQVLIYSSSERAFCAGGDVRAVRESVLEGDVAAGDKYFIDEFAMNNTLGTYPKPVISVINGVAMGGGMGISMHGSHRIVTEKAFASMPEMAIGYVPDVGFTYFGQRASSLAIATFLAVTGWRMSPADMLWAGVATHFVEDAQGFIDAVLNESLDSALEKFSTQPTGSSELAGVASQIEETFGHSSWALIDASLRSHPDAEFVAKVDGLMASAAPASVVATVKLMHQNSEATTLREGLDNELAMSLYMIRQPDFAEGVRAVLVDKDRNAAFSPANYEDVDESHFVTLFQHSS GT:EXON 1|1-339:0| BL:SWS:NREP 1 BL:SWS:REP 14->335|HIBCH_XENTR|4e-43|34.6|318/385| SEG 112->124|mgggmgismhgsh| SEG 258->267|asaapasvva| BL:PDB:NREP 1 BL:PDB:REP 14->329|3ju1B|4e-23|36.0|300/345| RP:PDB:NREP 1 RP:PDB:REP 9->336|3bptA|9e-36|26.6|319/352| RP:PFM:NREP 1 RP:PFM:REP 16->186|PF00378|3e-18|33.5|167/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 16->186|PF00378|3.9e-31|28.1|167/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 2->326|1wdkA4|2e-35|15.1|298/310|c.14.1.3| HM:SCP:REP 1->321|1wdkA4|1.1e-58|31.8|261/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 1191 OP:NHOMOORG 591 OP:PATTERN 11-----322232223-1-----3---1---2--------------------------------1-11 11--131311121223322-22111522222132323357-2-1---2----212321---2411-2--3----------1------------------1-111-2-1-1---------------------------11--------------------------------------------111-----1-11111111212111111211-1221-22211-------3------------------------------------------------------1------------------------------11------112-------111-2--1111-2-2-1--1-111214-14------1----1112-11-12133221-4221122222222222-11211222322-222-2213344322321211121122211111111211-1322------------------------------2212-232243333331222233433333233463553-1332-1122324133111----12----------3221441-----------222-2--------1111---------------------------11-12-312111111112111111121111----1----------------11--------1---------1----------------1-11111111111111-------1------------------111112222-1111---------------55545242222-22223432133444221-------------1-----12-111111111111-------1--1111------------------------------------------------- 11--641-752-22222212222221222222232225222222122233434212311222311111-1111111111111111111-131223211111-2555-35444533222223232642225H3-3431211523431222-22-22121235224212423-43212111711112757D2842232124 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 336 STR:RPRED 99.1 SQ:SECSTR ccccEEEEEETTEEEEEEccGGGTTcccHHHHHHHHHHHHHHHcTTccEEEEEEETTccEEEccccHHHHHHHcHHTcccccHHHHHHHHHHHHHHHTccccEEEEEccEETHHHHTTTTccEEEEEcTTcEEEEcGGGTTccccTTHHHHHHHccTHTHHHHHHHHcccEETHHHHHTTcccEEccGGGHHHHHHHHHcccccHHHHHHHHHTcHHHHHccTTTTcccTTGGGHHHHHHHTTcccHHHHHHHccHHHHHHHHHHTTcHHHHHHHHHHHHHTTccHHHHHHHHHHHHccHHHHHHHHHTTccccccccccccGGGccHHHHHHHHc### DISOP:02AL 1-1,339-340| PSIPRED cccEEEEEEEccEEEEEEccHHHcccccHHHHHHHHHHHHHHHccccccEEEEEccccccEEccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEHHHHHHHHHHHHHccEEEEccccEEEccccccccccccHHHHHHHHcccHHHHHHHHHccccccHHHHHHcccccEEcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccEEEEEEEcccccccccccHHHccHHHHHHHHcccc //