[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF53997.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:240 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF53997.1 GT:GENE BAF53997.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1127461..1128183 GB:FROM 1127461 GB:TO 1128183 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF53997.1 LENGTH 240 SQ:AASEQ MKPLGKIAVPWTWYLGIVGVIIFDVVAAITMLTLVPNKMPERVNSGLVALGGSYAPPMSRETLIARVIAGAVLVLVISLGISLLISAQSKNLASDHPDASAIQIARRWAFLNNIQSCIGWFSFFLAAILSISSLRLNGPGATTHLEMAVYIIAVSVLAWALMISLRRGQVAIDRAIPIREDDSELKWGMIYHDASDKRVFVELDDGHTTVINMARGGAWLLIAVMVLPALAIVGWVLLEN GT:EXON 1|1-240:0| TM:NTM 5 TM:REGION 15->37| TM:REGION 70->91| TM:REGION 116->137| TM:REGION 144->165| TM:REGION 217->239| SEG 63->89|liarviagavlvlvislgisllisaqs| SEG 121->134|fsfflaailsissl| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,92-94| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccEEEEEEEEcccccEEEEEEccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHccc //