[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54012.1
DDBJ      :             hypothetical protein
Swiss-Prot:PTH2_CORGL   RecName: Full=Peptidyl-tRNA hydrolase 2;         Short=PTH 2;         EC=3.1.1.29;

Homologs  Archaea  0/68 : Bacteria  891/915 : Eukaryota  98/199 : Viruses  0/175   --->[See Alignment]
c.56.3
:204 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->203 2jrcA PDBj 2e-27 40.5 %
:RPS:SCOP  26->204 2pthA  c.56.3.1 * 2e-49 37.6 %
:HMM:SCOP  22->205 1rybA_ c.56.3.1 * 7.9e-52 44.6 %
:RPS:PFM   26->169 PF01195 * Pept_tRNA_hydro 1e-37 52.4 %
:HMM:PFM   26->201 PF01195 * Pept_tRNA_hydro 2.9e-56 47.4 175/184  
:BLT:SWISS 1->204 PTH2_CORGL e-107 99.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54012.1 GT:GENE BAF54012.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1144626..1145240) GB:FROM 1144626 GB:TO 1145240 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54012.1 LENGTH 204 SQ:AASEQ MTSVSFLSKIQALFAPKPELPAAKWLVVGLGNPGAKYESTRHNVGYMCQDMLIDAHQQQPLTPATGYKALTTQLAPEVLAVRSTTFMNHSGQGVAPIAAALGIPAERIIVIHDELDLPAGKVRLKKGGNENGHNGLKSLTEELGTRDYLRVRIGISRPPAGMAVPDYVLEPVDHDQPGIELAAEAVDLLLAQGLSAAQNAIHSR GT:EXON 1|1-204:0| SW:ID PTH2_CORGL SW:DE RecName: Full=Peptidyl-tRNA hydrolase 2; Short=PTH 2; EC=3.1.1.29; SW:GN Name=pth2; OrderedLocusNames=Cgl0935, cg1067; SW:KW Complete proteome; Cytoplasm; Hydrolase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->204|PTH2_CORGL|e-107|99.5|204/204| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| SEG 180->191|elaaeavdllla| BL:PDB:NREP 1 BL:PDB:REP 26->203|2jrcA|2e-27|40.5|173/191| RP:PFM:NREP 1 RP:PFM:REP 26->169|PF01195|1e-37|52.4|143/183|Pept_tRNA_hydro| HM:PFM:NREP 1 HM:PFM:REP 26->201|PF01195|2.9e-56|47.4|175/184|Pept_tRNA_hydro| GO:PFM:NREP 2 GO:PFM GO:0004045|"GO:aminoacyl-tRNA hydrolase activity"|PF01195|IPR001328| GO:PFM GO:0006412|"GO:translation"|PF01195|IPR001328| RP:SCP:NREP 1 RP:SCP:REP 26->204|2pthA|2e-49|37.6|178/193|c.56.3.1| HM:SCP:REP 22->205|1rybA_|7.9e-52|44.6|184/191|c.56.3.1|1/1|Peptidyl-tRNA hydrolase-like| OP:NHOMO 1040 OP:NHOMOORG 989 OP:PATTERN -------------------------------------------------------------------- 1111122222221111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111111111111-111111111-111111111111111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111131111111111111111111111111111--1-111111111111111111111-1111111111111111111111111111111111111111-1111111111111111111111111-11-1111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111112222222---1-11111111111-11111111111111111111111-11111111 ----11------1121-111-----------------1111------1111-11----1----111111111111111111111111---11--1--------11---2-1-211111----1--1111261-11--1----113-11--1--11-1-2----11--------1-11116111212446141------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 87.7 SQ:SECSTR ########################EEEEEccccccGGGGGTTTHHHHHHHHHcEEETTTTEEEEEEEETEEEEETEEEEEEEccccHHHHHHHHHHHHHHHTccTTTEEEEEEEccccEEEEEEEccccccccHHHHHHHHHHcccccEEEEEEEccccccccHHHHHTcHHHHHHHHHHHHHHHHHHHHHTcHHHHHHHTTT# DISOP:02AL 1-2,129-130,204-205| PSIPRED ccHHHHHHHHHHHHccccccccccEEEEEcccccHHHHccccHHHHHHHHHHHHHHccccccccccEEEEEEEcccEEEEEEcccHHHccHHHHHHHHHHHcccHHHEEEEEEcccccccEEEEEccccccccccHHHHHHHHccccccEEEEEEccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHcc //